KEGG   Acinetobacter oleivorans: AOLE_10250Help
Entry
AOLE_10250        CDS       T01263                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00010  Glycolysis / Gluconeogenesis
acd00020  Citrate cycle (TCA cycle)
acd00620  Pyruvate metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01130  Biosynthesis of antibiotics
acd01200  Carbon metabolism
Module
acd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOLE_10250
   00020 Citrate cycle (TCA cycle)
    AOLE_10250
   00620 Pyruvate metabolism
    AOLE_10250
Enzymes [BR:acd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AOLE_10250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADI90939
UniProt: D8JKB8
Position
complement(2212870..2214360)
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGNTLPVGGLI
AVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPIAEKAEQPQSVAASAPAP
VKVAKGDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVTGFGREGRISVQDIQKA
VQAAGGQWPDVKQQTQAKVVKSTADDSRVSATPVARRLAKEWGINLNDCRISGTRGRVCK
EDVEAVYYRNNPASVNEQSAQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQNLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgattgcccaatggttgattaaagaaggcgatagctttaataaaggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtgttagaagcaccttttgca
ggaacgctccgtaaaattttagcgaaagatggtaatactttacctgttggtggtcttatt
gccgtatgtgctgatagtgaagtttctgatgcagaaattgaaaagtttatcgcatcatta
ggtggttcagcagctcaagcacctgaagcaccttcggaacaaagtaaagcggaaacatct
gcacctattgctgaaaaagccgaacaaccacagtctgtagctgcaagtgctccagctcct
gtaaaggtagcgaaaggtgactatgctgtacctgagtcattacaaggctatcaaacatct
gatgagttgtttgcaacgccgcatgcgttaaagcttgcagaaaaacacaatgtaaacttg
gcaaaagtcacaggttttggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtacaagcagctggaggtcagtggcctgatgttaagcagcaaactcaggctaaagtggtt
aaatctacggctgatgatagtcgagtttcagcgacacctgtagcacgccgtttagcaaaa
gaatggggcattaatctaaatgactgccgtatttcaggtactcgtggccgtgtctgtaaa
gaagatgttgaagcggtttactaccgtaataaccctgcatcggtaaatgaacaatctgct
caatgtgctgctcaaccacaatcgaccgttactactgtcgcgatgaatggtatgcgtaaa
gcaattgcttcacggctacaggctgcaaaacgtaatgcaccacatttccgcttagtggtc
gatctaaacgtagaggctttgcaaaatttacgtaaacagattaatgagaccgttccgcaa
gtgaaactttctattaatgacatgctaattaaagcggcggcagcggcactgattaaagtg
cctgaggtgaatgttcaatttgatgaggcgactcaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagca
aatcagaagtctttagcacaaatttctgatgacatgcgtgatttggcaacacgcgctaag
actggcaagttacaacctgatgagtttcaaggcggcagctttagcatttcaaatttagga
atgttaggcattaaacaattcgacgccattattaacccaccgcaaggtgcaattatggca
ttaggtgcttctgaatcacgtgctgttgttgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgtgatcaccgagttattgatggtgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaatcctgctttaattttggtgtag

DBGET integrated database retrieval system