KEGG   Acinetobacter oleivorans: AOLE_10300Help
Entry
AOLE_10300        CDS       T01263                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOLE_10300
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOLE_10300
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AOLE_10300
Enzymes [BR:acd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AOLE_10300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2225039..2226244)
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTAEFQNELSDLFTNY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVAVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKDQTHQRFGKSPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLEAFMTLSRVEGIVPALES
SHAVAWAIREAPKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaacggtattgctttgccgaatgaacaaggattttttggtgaatat
ggcggacaattcattcctccacatttaaaagaagcaatggatgaaattaatgttgcctat
gaagaaattcgccatacagctgaatttcaaaatgaactatcagacctctttacgaattat
gtaggccgtccaagtccgttatttcatgcgaagcgtttgtctgaacagttaggtggcgca
caaatttacttaaaacgtgaagatttgaaccacactggtgcccacaaaattaatcactgc
ttaggtgaagctttacttgctaaatatatgggcaaaaagaaagttattgctgaaacaggt
gctggtcagcatggggtcgctttggcaaccgcttgtgcattagtaggaattccctgtgaa
attcacatgggtcaagtcgatatcgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggtgctcatttggtggcagttacacgtggtacagcaacattaaaagatgctgtagat
agtgcatttgaagaatatttaaaagatcctaaaaactttatatatgctattggttctgtt
gtaggtccacatccattccctaaaatggttcgcgattttcaatcgattattggcaatgaa
attaaagatcaaacacatcagcgatttggaaaaagtccagattatgttgtggcatgtgta
ggtggtggttcaaatgcaataggtgcatttactgcatttttaaatgactcagacgtaaaa
cttgttggggttgagccagctggacatggtttagaaaccaatatgcactcagcaacgcta
actttaggtaagccaagtcaaattcatggtatggcgtgttatgtgcttgaaaatgaggct
ggtgaacctttacccgtgcattctattgcctcaggactagactatccaggtgttgggcca
caacacagttttttaaaagatttaggtcgtgttgaatatagcactgcaactgatcaagaa
tgtttagaggcttttatgacactttctcgtgttgaaggcattgttcctgcacttgaaagc
tcacacgctgtcgcatgggcaattcgtgaagcaccaaaactgccgaaagaaaccatgatt
gtggtgaatctatcgggccgtggagataaagactctgattatgttgccgaaaagcttaag
ctttaa

DBGET integrated database retrieval system