KEGG   Acinetobacter oleivorans: AOLE_10495Help
Entry
AOLE_10495        CDS       T01263                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
acd  Acinetobacter oleivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AOLE_10495
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     AOLE_10495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261221..2261820)
Genome map
AA seq 199 aa AA seqDB search
MGKFRIDLLRHGESQYSHTLRGHLDDELTEKGWQEMQSTIEQVANQSWDVIISSSLKRCA
CFAEQLAKTTQLPLLLNHDLKEMYFGEWEGVSTQQIYETSPELLANFWQKPSQYCPPRAE
TLMQFQTRVLKGFQELLIEMQNQNWQHGLVVTHGGVIKLLACLAKQQSLDDLLKMPAELG
KLYSFEFSETDGQLTFMLR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaattcagaatcgatttactcagacatggcgagagtcaatatagccatacttta
cgtggccatttggatgatgagttaacggaaaaaggttggcaggaaatgcagtcaaccatt
gagcaagttgcaaatcagtcatgggatgtcattataagttcatcattaaaacgttgtgct
tgttttgctgagcaacttgcaaagacaactcagctacctttacttttaaaccatgactta
aaagaaatgtattttggtgagtgggaaggcgtctcaactcagcaaatttatgaaacttca
ccagaattactggcaaatttttggcaaaaaccgagtcagtattgcccacctcgtgcagaa
acattaatgcagtttcaaacaagggttcttaaaggctttcaagaactactcatagaaatg
caaaaccaaaactggcaacatggattggttgttacccacggtggtgtaattaagctattg
gcttgtttagccaagcaacaatctttagatgatttactgaaaatgccggcagagcttggg
aaattatattcattcgaattttctgaaacagatggtcaattaactttcatgttgagatag

DBGET integrated database retrieval system