KEGG   Acinetobacter oleivorans: AOLE_10495Help
Entry
AOLE_10495        CDS       T01263                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
acd  Acinetobacter oleivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261221..2261820)
Genome map
AA seq 199 aa AA seqDB search
MGKFRIDLLRHGESQYSHTLRGHLDDELTEKGWQEMQSTIEQVANQSWDVIISSSLKRCA
CFAEQLAKTTQLPLLLNHDLKEMYFGEWEGVSTQQIYETSPELLANFWQKPSQYCPPRAE
TLMQFQTRVLKGFQELLIEMQNQNWQHGLVVTHGGVIKLLACLAKQQSLDDLLKMPAELG
KLYSFEFSETDGQLTFMLR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaattcagaatcgatttactcagacatggcgagagtcaatatagccatacttta
cgtggccatttggatgatgagttaacggaaaaaggttggcaggaaatgcagtcaaccatt
gagcaagttgcaaatcagtcatgggatgtcattataagttcatcattaaaacgttgtgct
tgttttgctgagcaacttgcaaagacaactcagctacctttacttttaaaccatgactta
aaagaaatgtattttggtgagtgggaaggcgtctcaactcagcaaatttatgaaacttca
ccagaattactggcaaatttttggcaaaaaccgagtcagtattgcccacctcgtgcagaa
acattaatgcagtttcaaacaagggttcttaaaggctttcaagaactactcatagaaatg
caaaaccaaaactggcaacatggattggttgttacccacggtggtgtaattaagctattg
gcttgtttagccaagcaacaatctttagatgatttactgaaaatgccggcagagcttggg
aaattatattcattcgaattttctgaaacagatggtcaattaactttcatgttgagatag

DBGET integrated database retrieval system