KEGG   Acinetobacter oleivorans: AOLE_10665Help
Entry
AOLE_10665        CDS       T01263                                 

Definition
PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase, converts PAPS to
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
acd  Acinetobacter oleivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:acd00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2294558..2295415)
Genome map
AA seq 285 aa AA seqDB search
MFITTTRPQDTLINQLLPVLEQASQILLQEYQNYSAGYEFTIHEKQDDSPVTQADLKVNL
FLLKHLAEITPDLPVLSEESDYSARHDWSTCWMLDPLDGTKEFIHERDEFTINLSLIKGK
ETIFSVIAVPCEQVVYLGYLQDLPFKYSFTQKQWYQYQITSPSLDVPIQIGLSHGSKNPK
YQRFIQPIEKEHNIIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLDGKPFEYNQRHTVLNKGFIAFRDQESKKIAFEALAQSGVID
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaactacgcgcccacaagatactttgattaatcagcttcttccagtcttg
gaacaagcgagccagatcctattacaagaatatcaaaattattctgcgggttatgagttt
actattcatgaaaaacaagatgattcacctgtaactcaagcagatttaaaagtgaatctt
ttcttattaaagcacttggcagagattaccccagacttgcctgttttgtctgaagaaagc
gattatagtgctcgccatgactggtctacgtgttggatgttagatccgcttgatggaact
aaagagtttattcatgagcgtgatgaattcacgattaacctaagcttgattaaaggtaaa
gagacaatcttttcagttattgcggtgccatgtgaacaagtcgtgtatttaggatatctg
caagatttaccttttaaatatagctttactcaaaagcagtggtatcaatatcagataact
tcgccttcgctagatgtacctatacaaataggacttagtcatggcagtaaaaatccgaaa
tatcaaagatttattcagcctatcgaaaaagaacataacattattagaagagaagcagga
agtgcctataaattttgcatgatgttggaaggtgaaatagatatttacccgcgattccat
ccaacttctgaatgggacacaagttctggtcaagggttgttggaaagtataggtggtggt
ttacttactcttgatggaaaaccttttgaatataaccagagacacacggttttaaataag
ggctttatcgcatttcgtgatcaagaaagcaaaaaaatagcatttgaagcattagcccaa
tcaggtgttatagattga

DBGET integrated database retrieval system