KEGG   Acinetobacter oleivorans: AOLE_10665Help
Entry
AOLE_10665        CDS       T01263                                 

Definition
PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase, converts PAPS to
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
acd  Acinetobacter oleivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AOLE_10665
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AOLE_10665
Transfer RNA biogenesis [BR:acd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AOLE_10665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2294558..2295415)
Genome map
AA seq 285 aa AA seqDB search
MFITTTRPQDTLINQLLPVLEQASQILLQEYQNYSAGYEFTIHEKQDDSPVTQADLKVNL
FLLKHLAEITPDLPVLSEESDYSARHDWSTCWMLDPLDGTKEFIHERDEFTINLSLIKGK
ETIFSVIAVPCEQVVYLGYLQDLPFKYSFTQKQWYQYQITSPSLDVPIQIGLSHGSKNPK
YQRFIQPIEKEHNIIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLDGKPFEYNQRHTVLNKGFIAFRDQESKKIAFEALAQSGVID
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaactacgcgcccacaagatactttgattaatcagcttcttccagtcttg
gaacaagcgagccagatcctattacaagaatatcaaaattattctgcgggttatgagttt
actattcatgaaaaacaagatgattcacctgtaactcaagcagatttaaaagtgaatctt
ttcttattaaagcacttggcagagattaccccagacttgcctgttttgtctgaagaaagc
gattatagtgctcgccatgactggtctacgtgttggatgttagatccgcttgatggaact
aaagagtttattcatgagcgtgatgaattcacgattaacctaagcttgattaaaggtaaa
gagacaatcttttcagttattgcggtgccatgtgaacaagtcgtgtatttaggatatctg
caagatttaccttttaaatatagctttactcaaaagcagtggtatcaatatcagataact
tcgccttcgctagatgtacctatacaaataggacttagtcatggcagtaaaaatccgaaa
tatcaaagatttattcagcctatcgaaaaagaacataacattattagaagagaagcagga
agtgcctataaattttgcatgatgttggaaggtgaaatagatatttacccgcgattccat
ccaacttctgaatgggacacaagttctggtcaagggttgttggaaagtataggtggtggt
ttacttactcttgatggaaaaccttttgaatataaccagagacacacggttttaaataag
ggctttatcgcatttcgtgatcaagaaagcaaaaaaatagcatttgaagcattagcccaa
tcaggtgttatagattga

DBGET integrated database retrieval system