KEGG   Acinetobacter oleivorans: AOLE_10740Help
Entry
AOLE_10740        CDS       T01263                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
acd  Acinetobacter oleivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOLE_10740
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOLE_10740
   00630 Glyoxylate and dicarboxylate metabolism
    AOLE_10740
Enzymes [BR:acd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AOLE_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2313083..2315248)
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYSLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEVFPLA
QGSHADATKYAIEQNKLVVTLKDGSKTGLAHEAQFVGFNGEEANPTEVVLLSNGLHVIIE
IDASSPIGQTDLAGVKDLTFEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRDLNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSVADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQAIGLPPKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKSGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPA
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFAPETNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgatcttagcccaaaaaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcatcgcaacaataaatttgaattaggtgcttataaggcg
ttcttaacagaaattggttatttattgccagaagttgaagactttcaaattacaactgaa
aacgttgatgaagaaatcgcattattggcagggccgcagttagttgtacctgtacgtaat
gcacgttatagcttaaacgcagcaaatgctcgttggggctctttatatgatgcactttat
ggcttcgatgtaatttctgaagaaggcggagctgaaaaaggtaaaggatataaccctgta
cgtggtgcaaaagtgattgagttcgctaaaaacttcttaaatgaagttttcccacttgca
caaggctcacatgcagatgcgacaaaatatgcaattgagcaaaacaaacttgttgtgact
ttgaaagatggttcaaaaacaggtttagctcatgaagctcagttcgttggtttcaacggt
gaagaagcgaaccctacagaagttgttcttttaagtaatggccttcatgtcattatcgaa
attgatgcatctagcccaattggtcaaactgatttagcgggtgtaaaagacttaacattt
gaagcggctgtaactactattcaggatttagaagattctgttgcggcagtagatgctgaa
gaaaaagttgaaggttaccgtaactggttaggtttaatgaaaggtacgcttcaagaatct
atcgagaaaaatggtaaaacgattgttcgtgatttaaataaagatcgcgaaattaaaaac
ttaattggtggtacaacgaaacttcatggtcgttcacttatgttacttcgtaatgtaggc
catttaatgactaacccagcgattttagtagatggtgaagagattttcgaaggtattatg
gatgcattggtaacaccattgttgtcagttgcggacattcgtagtgaaaacgaaaataag
aactctcgtaaaggttctatgtatattgttaagccaaaaatgcatggtccagaagaagtt
gcgtttgctgtagagttgtttgaacgtgctgaacaagcgattggcttaccgcctaaatcg
ttaaaaatcggtattatggatgaagagcgccgtacatctgtaaacttgaaaaactgtatt
gctgctgcaaaagaccgcacgatctttattaatactggtttcatggaccgtactggtgat
gaaattcatacttcaatggaagctgcaccagttgttcgtaaagaagccgtaaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaattggtttgaagtcaggtttacaa
ggtaaagcacaaattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgcacatccaaatgcgggtgcttcatgtgcttgggttccatctccagca
ggtgcagtacttcatgcgatgcattaccatcaagtgaatgttaaagcacgtcaagatcag
ttgaaagctgaagaaatgttgtcattagatgacttgttaactcctccctttgcaccagaa
acaaactggtcagcagaagaaatcaacaatgagcttgaaaataactgccaaggtatttta
ggttacgttgttcgttgggttgacttaggcgtgggttgttcgaaagttcctgacattaat
aatgtaggcttaatggaagaccgtgcaacattacgtatttcttctcaacacgtagcaaac
tggttacgtcacggtattgtgactcgtgaacaagttgaagaagtacttaaacgcatggca
aaaattgttgatgagcaaaatgcgaatgatccattgtataaaccaatggctgctaatttt
gaaactaacattgctttccaagccgcttctgatctcatctttaaaggttgtgaacagcct
tcaggttatactgagccgttacttcatgctgctcgtttaaagttaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system