KEGG   Acinetobacter oleivorans: AOLE_10740Help
Entry
AOLE_10740        CDS       T01263                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00620  Pyruvate metabolism
acd00630  Glyoxylate and dicarboxylate metabolism
acd01100  Metabolic pathways
acd01110  Biosynthesis of secondary metabolites
acd01120  Microbial metabolism in diverse environments
acd01200  Carbon metabolism
Module
acd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOLE_10740
   00630 Glyoxylate and dicarboxylate metabolism
    AOLE_10740
Enzymes [BR:acd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AOLE_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADI91037
UniProt: D8JKZ7
Position
complement(2313083..2315248)
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYSLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEVFPLA
QGSHADATKYAIEQNKLVVTLKDGSKTGLAHEAQFVGFNGEEANPTEVVLLSNGLHVIIE
IDASSPIGQTDLAGVKDLTFEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRDLNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSVADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQAIGLPPKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKSGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPA
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFAPETNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgatcttagcccaaaaaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcatcgcaacaataaatttgaattaggtgcttataaggcg
ttcttaacagaaattggttatttattgccagaagttgaagactttcaaattacaactgaa
aacgttgatgaagaaatcgcattattggcagggccgcagttagttgtacctgtacgtaat
gcacgttatagcttaaacgcagcaaatgctcgttggggctctttatatgatgcactttat
ggcttcgatgtaatttctgaagaaggcggagctgaaaaaggtaaaggatataaccctgta
cgtggtgcaaaagtgattgagttcgctaaaaacttcttaaatgaagttttcccacttgca
caaggctcacatgcagatgcgacaaaatatgcaattgagcaaaacaaacttgttgtgact
ttgaaagatggttcaaaaacaggtttagctcatgaagctcagttcgttggtttcaacggt
gaagaagcgaaccctacagaagttgttcttttaagtaatggccttcatgtcattatcgaa
attgatgcatctagcccaattggtcaaactgatttagcgggtgtaaaagacttaacattt
gaagcggctgtaactactattcaggatttagaagattctgttgcggcagtagatgctgaa
gaaaaagttgaaggttaccgtaactggttaggtttaatgaaaggtacgcttcaagaatct
atcgagaaaaatggtaaaacgattgttcgtgatttaaataaagatcgcgaaattaaaaac
ttaattggtggtacaacgaaacttcatggtcgttcacttatgttacttcgtaatgtaggc
catttaatgactaacccagcgattttagtagatggtgaagagattttcgaaggtattatg
gatgcattggtaacaccattgttgtcagttgcggacattcgtagtgaaaacgaaaataag
aactctcgtaaaggttctatgtatattgttaagccaaaaatgcatggtccagaagaagtt
gcgtttgctgtagagttgtttgaacgtgctgaacaagcgattggcttaccgcctaaatcg
ttaaaaatcggtattatggatgaagagcgccgtacatctgtaaacttgaaaaactgtatt
gctgctgcaaaagaccgcacgatctttattaatactggtttcatggaccgtactggtgat
gaaattcatacttcaatggaagctgcaccagttgttcgtaaagaagccgtaaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaattggtttgaagtcaggtttacaa
ggtaaagcacaaattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgcacatccaaatgcgggtgcttcatgtgcttgggttccatctccagca
ggtgcagtacttcatgcgatgcattaccatcaagtgaatgttaaagcacgtcaagatcag
ttgaaagctgaagaaatgttgtcattagatgacttgttaactcctccctttgcaccagaa
acaaactggtcagcagaagaaatcaacaatgagcttgaaaataactgccaaggtatttta
ggttacgttgttcgttgggttgacttaggcgtgggttgttcgaaagttcctgacattaat
aatgtaggcttaatggaagaccgtgcaacattacgtatttcttctcaacacgtagcaaac
tggttacgtcacggtattgtgactcgtgaacaagttgaagaagtacttaaacgcatggca
aaaattgttgatgagcaaaatgcgaatgatccattgtataaaccaatggctgctaatttt
gaaactaacattgctttccaagccgcttctgatctcatctttaaaggttgtgaacagcct
tcaggttatactgagccgttacttcatgctgctcgtttaaagttaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system