KEGG   Acinetobacter oleivorans: AOLE_11335Help
Entry
AOLE_11335        CDS       T01263                                 

Definition
Peroxiredoxin HYR1(Hydrogen peroxide resistanceprotein 1)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
acd  Acinetobacter oleivorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AOLE_11335
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AOLE_11335
Enzymes [BR:acd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AOLE_11335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2430477..2430962)
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGEVKQLADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGTFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
STIKWNFTKFLVGKDGAVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatttatcagtttgaagctgaactgttagagggtgaagttaagcaattagct
gattacaaaggtaaagttttactaattgtaaatactgcaagtaaatgtggttttacacca
caatttgctggccttgaaaagctttatgagaaatataaagatcaaggcttggaagtttta
gggtttccctgcaaccagtttggtgggcaagatccgggtagcaataaagaaatcggtacg
ttctgccagcgcaactatggggtgaaatttccgatgtttgctaaagtagatgtaaaagga
ccagaagctcacgtcatttttagatatttgacacgtgaagctaaaggcattttaggaagc
agcacgattaaatggaactttactaaatttttggtagggaaagatggtgcagtgcttaat
cgctatgcgcctacgactaaaccagaagcattagaagctgatattgaaaaagcattagct
agttaa

DBGET integrated database retrieval system