KEGG   Acinetobacter oleivorans: AOLE_12720Help
Entry
AOLE_12720        CDS       T01263                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
acd  Acinetobacter oleivorans
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:acd00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2726941..2727963
Genome map
AA seq 340 aa AA seqDB search
MLLSHLPRVQLVHAPTPLEFLPNLTKALNGPQIYIKRDDATGLATGGNKTRKLEFLIGDA
LTKGATHVLTQGATQSNHVRQTIAAANKFGLKASVLLEQRVSDGTDEYYNNGNLLLDEIL
GATSIEVVPGGTDMVAALEAKAKELELQGERPYIIPGGGSNAIGALGYVSTAIELINQLN
QIQLAPTHLVHATGSTGTQAGLLAGIAVTHSNLPVLGISVRAEKSKQEENVYKLTRATLE
HLGLSADLIAREKVIANSDYVGDGYGIPTDSMVEAVELLARTEGILLDPVYSGKGFAGLV
DLIRQGHFTKDDKVIFLHTGGAVGLFGYRKTFSNKDAYRL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaagtcatttaccgcgcgttcaactggttcatgcgcctactcctctagagttt
ttacctaacttaactaaagcgttaaatggtccccagatttacatcaaacgagacgatgct
acagggctggctacaggtggcaataaaactcgcaaattagaatttttaattggtgatgca
cttacaaaaggtgcaacccatgtacttactcaaggtgcaactcaatctaaccatgttcgc
caaacgattgcagcagcaaataaatttggtttaaaggcatcagttttactcgaacaacgc
gttagtgatggtacagatgaatattacaataatggaaacttattgctcgatgagatttta
ggtgcaacatcaattgaggtagttccgggtggcaccgatatggtggcagctttagaagcc
aaagcaaaagaattagaactacaaggggaacgtccgtacattattccaggtggtggttca
aatgctattggtgctttaggttatgtctcaacagcaattgaattaattaaccaacttaac
cagattcaactggctccgactcatcttgtacatgcaacaggtagcacaggtactcaagct
ggccttttagcgggtattgcggtaactcactcaaacttacctgtactcggtatcagtgtt
cgtgctgaaaaatctaaacaagaagaaaatgtttataaacttactcgtgcaactttagaa
catctgggtttaagcgcagatcttattgctcgtgaaaaagtgattgcgaatagtgactat
gttggcgatggctacggtattccaactgatagcatggttgaggctgttgaattgctggct
cgaactgaaggtattttgcttgaccctgtttactcaggtaaaggttttgcgggtttagta
gatctcattcgtcagggtcatttcactaaagatgacaaagtgatcttccttcatacaggc
ggtgccgtaggcttattcggttatcgtaaaacattctctaacaaagatgcataccgtttg
taa

DBGET integrated database retrieval system