KEGG   Acinetobacter oleivorans: AOLE_13475Help
Entry
AOLE_13475        CDS       T01263                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00240  Pyrimidine metabolism
acd00250  Alanine, aspartate and glutamate metabolism
acd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AOLE_13475 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOLE_13475 (pyrB)
Enzymes [BR:acd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AOLE_13475 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADI91582
UniProt: D8JP08
Position
complement(2870134..2871150)
Genome map
AA seq 338 aa AA seqDB search
MHIAALHQPSQVQLNQDGNLKHFLTIEGLSKENLTKILDTAQSFLDDNNNLINRPLLEGL
TVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADIFV
VRHSSSGAAHFIAKDVCPKVAIINAGDGRHAHPTQAMLDMLTIRRETKKPFEELSVAIIG
DIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPVGFSEYGEHVRLFNNMDAGIADCDVII
ALRIQNERIDSPALSSQSEFYRMYGLNKERLGLAKPDCIVMHPGPMNRGVEIDSSIADGD
QSVILKQVTNGIAVRMAVLALSMQGQLQEQGLIEAITL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgcagcgttgcatcagccgagccaggttcagctcaatcaggacggaaattta
aaacattttttaacaattgagggactttcaaaagaaaacctcacgaagattttagatacc
gcacaaagctttttagatgataataataatttaattaatcgtccgctcttagagggattg
acggttatgaatcttttctttgaaaactccacccgtactcgtactacttttgaagcagca
gcaaaacgcttgtctgccaatgtattgaatattgatattgcacgttcaagtacatcaaaa
ggtgaaacgctacgagatacgctttggaaccttgaagcaatggctgccgatatttttgtt
gtccgccattcatcttcgggcgctgcacatttcattgctaaagatgtatgtccaaaggtc
gcgattattaatgctggagatggacgtcatgctcatccaacgcaagcgatgcttgatatg
cttacaattcgccgtgaaacaaagaaaccttttgaagagttgagtgttgccattattgga
gacatcaaacactctcgcgtagcacgttctgatgtagcagcattacaaacactaggatgt
aaagatattcgcgtgattgcaccgaatacattattgccagtgggcttttcagaatatggc
gaacacgttcgcttatttaataacatggatgctgggattgcggattgtgatgtgattatt
gctctacgtattcaaaatgaacgtattgactctccagcattatcttcacagtctgaattc
tacagaatgtatggtttaaacaaagagcgtcttggtttagctaaaccggactgtattgtc
atgcatccagggccaatgaatcgtggtgtagaaattgactcaagtattgcggatggggac
caatcagttattttgaaacaagtaaccaatggtattgctgttcgtatggctgtgttggcg
ctgtcaatgcaaggccaactccaagagcaaggtttaattgaagcgattacgttgtaa

DBGET integrated database retrieval system