KEGG   Acinetobacter oleivorans: AOLE_14415Help
Entry
AOLE_14415        CDS       T01263                                 

Definition
multifunctional protein (Includes: acyl-CoA thioesterase I; protease I; lysophospholipasel(I))
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
acd  Acinetobacter oleivorans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AOLE_14415
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AOLE_14415
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AOLE_14415
Lipid biosynthesis proteins [BR:acd01004]
 Fatty acid synthase
  Component type
   AOLE_14415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3078360..3078983
Genome map
AA seq 207 aa AA seqDB search
MYKSFLIGSKSIMLISLSMLPMLVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQY
PKQHKVVNASVSGETTSGALARLPKLLQTYKPNVVVIELGGNDGLRGQPPQMIQKNLDQL
IQLSQKQKAQVILFGMKIPPNYGAAYSKAFENNYKVVSQKYQVKLLPFFLDGVAGQKQLM
QNDLIHPNAQAQSKLLNLAYPYIKGAL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatcttttttgattggttctaaaagcatcatgctcatctcattaagtatgctg
cctatgcttgtatcggcgaaaactattttaattttaggagatagtattagtgccggttac
ggaattgatcccaaacaaggttgggtacaattactgcaaaaacgcttagaccaacagtat
cccaaacaacacaaagtggtcaatgcaagtgttagtggagaaacaaccagcggcgcttta
gcccgattacctaagctattacagacttataagcccaatgtggtcgtgattgaattaggc
ggaaatgatggcttacgtggtcaaccacctcaaatgattcaaaaaaatcttgatcagctc
attcagttaagtcagaaacaaaaagcccaagttattctttttggcatgaaaattccgcca
aattatggggctgcgtatagcaaagcttttgaaaataactataaagttgtcagccaaaaa
tatcaggtgaaattactaccattttttcttgatggagtcgcaggtcaaaaacagcttatg
caaaatgacttgattcatccaaatgctcaagcacaatcaaaattacttaatttagcttat
ccatatataaaaggtgccctgtag

DBGET integrated database retrieval system