KEGG   Acinetobacter oleivorans: AOLE_14520Help
Entry
AOLE_14520        CDS       T01263                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOLE_14520
   00052 Galactose metabolism
    AOLE_14520
Enzymes [BR:acd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AOLE_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3105931..3107076
Genome map
AA seq 381 aa AA seqDB search
MKKLVILSFTLYSFAQITNAATLNVKPYGTTQDGQKVDLYTMSNNKGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLVSKGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFQIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRILVTDQNSL
PTGEIASVAGTPFDFRTPKAIVKDIRANHQQLAYGYGYDQTWVLNQKSQGKLNLAAHVFD
PKSKRTLQVLTTEPSVQMYTANHLLGNIAGANGVLYRQADALALETQHFPDSPNQPSFPS
TRLNPNQTYNSVTVFKFGIQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtaattttaagtttcaccctttatagctttgcgcaaattacaaatgca
gcaacattaaacgtaaaaccctacggcacaactcaagatggtcaaaaagttgatctatac
accatgagcaataacaaaggagtctcggtttcttttattagttttggtggggtaattacc
cagattttgactcccgatgcacaaggtaaacaaaataatattgttttaggcttcgatgac
ctaaaaggctatgaagttactgatactaaggaaggcattcattttggtgggttaattggc
cgttatgcgaatcgtattggcaatgctaaatttagcttagatggaaaaacatataatctt
gaaaaaaataatggaccgaattcattacatagcggtaatccgggttttgataaacgtgtt
tggcaagttaagcccttggtttctaaaggtgaaaccgttaaagcttctcttaagttaacc
agtccaaatggtgatcaaggttttccggggaaattagatgtagaagtgatctacagtctt
tcagatcaaaatgaattccagatcgaatataaagctaaaactgatcaaccgacagtcgtc
aatctcaccaaccacagttatttcaacttatcaggcgctggcaataacccttatggtgtg
ctcgatcatgttgtacaacttaatgcagaccgtatattggtaaccgatcaaaactcttta
cccacaggtgaaatagcttcggttgcaggtacaccttttgattttcgaacgcctaaagca
attgtgaaagatattcgagcgaatcatcagcaattggcctatggatatggctatgaccaa
acttgggtacttaatcaaaagtctcaaggaaagttaaatcttgctgctcatgtttttgac
ccaaaatctaaacggacactgcaagtcttgactactgaaccaagcgttcaaatgtataca
gccaatcatttactgggaaatattgctggggcaaatggcgtactctatcgacaagcagat
gcgctagcattagaaacgcagcattttccagatagtccgaatcaaccatctttcccttct
acacgtttgaacccaaatcaaacttataacagtgtcaccgtatttaagtttggtattcaa
aaatag

DBGET integrated database retrieval system