KEGG   Acinetobacter oleivorans: AOLE_17140Help
Entry
AOLE_17140        CDS       T01263                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
acd  Acinetobacter oleivorans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:acd00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:acd00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3652219..3652728
Genome map
AA seq 169 aa AA seqDB search
MAWQNVEVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRAL
PNRVNWIITRDINWQFDGVKIAYSIEDALNAALEDVKNTEKQALFIIGGGEIFKQTLSIA
DRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaaatgtagaagttgttcacgttgtggcaatggataaaaaccactgtatt
ggtaagggcaatgcgttgccatggcatatttctgccgacttaaaacactttaaagaaatc
acccaaggtggcgtggtcatcatgggtcgtaaaacccttgagtctatgggccgtgcgcta
ccaaaccgtgtgaactggatcattacccgtgacattaactggcaatttgacggtgttaaa
attgcctattcaattgaagatgctttaaatgcagctttagaagatgtaaaaaatactgaa
aagcaggcattgttcatcattggtggcggtgagatattcaagcaaactttgtcaattgca
gaccgtcttgaacttactcatgttgacttagatgtgcaaggtgatgcacattatccgaca
ataccgagtgaatttcataaaactgcaagtgaacagcaagttgatgaaaaatcaggaact
tcattcgagtttgccacttataaaaaataa

DBGET integrated database retrieval system