KEGG   Acinetobacter oleivorans: AOLE_17640Help
Entry
AOLE_17640        CDS       T01263                                 

Definition
exonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acd  Acinetobacter oleivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AOLE_17640
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AOLE_17640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3755978..3757729)
Genome map
AA seq 583 aa AA seqDB search
MDNLNSSEQADLSWLTTWSNFLNQAPFTEQSQGSEATSYLQQLIEASLQGDSCIDVSSEQ
IAALGQLAISADQATSNVAPCVYDEQGLALYRYWHLEQRLAEQICRLKQQLIQPVSCDDY
LDLLTDPHQQAALQMVARQSLSIITGGPGTGKTYTLARIIAVLSQTIPNIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLVSEELRNQGTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLLEAVPESCRIILLGDANQLASVDVGAVLADLQQIQALAANRVQ
LQTSRRFAEGALIGQVARFIQMRTSQINHEQVLQQFEIDIVEVSELKPIVLQSDMPDVVQ
LEYLPEGNHAEVEIYYQKLMLGFQGYVKSLKNYLKEERSIEQVQNVVKAFDDYRILTAVR
HGPFGLQQLNQYAQRWIQQQLSIVVAGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVHPEALLQSFTIRTTRKSGLVQKVNRLVR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctaaatagctctgaacaggccgatttaagctggttaacaacgtggagtaac
ttcttaaatcaggctccatttactgagcaatcgcaagggtcagaagccacttcttacttg
cagcagcttattgaagcgagcttacaaggcgatagctgtatcgatgtcagttctgagcaa
attgcagcacttggtcagcttgctatatctgccgatcaagcaacttcaaatgttgcccca
tgcgtctatgatgagcaggggttggcattataccgatattggcacctagagcaacgactt
gcagaacaaatttgtcgattaaagcaacaattaattcaacctgtatcttgtgatgactac
ttagacctactcacagacccgcatcaacaggcagctttacaaatggttgctcggcagagc
ctgagtattattacgggtgggccaggtacgggtaagacctatacgcttgcacgtattatt
gcagtgcttagccaaacaattccgaatattcgtgtggcgatggctgctccaacaggtaaa
gccgcacagcgcatgcaagaggccttacagaactcatttaatgaccctaaattgcttgag
tctggattagtgagtgaagaactaaggaatcagggaacgcaaacaattcaccgattattg
gggatgggacatagtcaaacaccacggtttaatcaaaaacaaccgcttccttatgacgtg
attgttgtggatgaggcttccatgctggatttaaatctagctactcttctacttgaagca
gtgccagagtcttgtcgaattattttattaggagatgcaaatcagctggcttccgtcgac
gtcggagcggttcttgctgacttgcaacaaatacaggcactcgccgctaacagagtacaa
ttacaaaccagtcgccgttttgctgaaggtgcattgattgggcaggtggcacgttttatt
caaatgcgaaccagtcagatcaatcatgagcaggttttgcaacagtttgaaattgatatt
gttgaggtttctgaattaaagcctatagttttacaaagtgacatgccagatgtggttcag
cttgagtatttgccagaagggaatcacgcagaagtcgaaatttattatcagaagctcatg
ctcggtttccaaggatatgtaaaaagcctaaaaaattatttaaaagaagaacgctctatt
gaacaggtccaaaacgtagtaaaagcatttgatgactaccgtattttaacggctgttcgt
catggtccatttggcttacagcagttaaatcaatatgcgcagcgttggatacagcaacaa
ctttcaatagtggtagctggggggtggtatgtcggtcgtccggtaatgatgacttataac
gactatcagctcggtatttcaaatggtgacattggtctgtgttttgaacacagaactcag
ccacagcaatttgaagtatattttccaagtttgaataaatgggtcgctgcaaatcgatta
cctaaaagtattcaaagtgcattcgctttaacgattcataaatcgcaagggtctgaattt
acacacactgctgtcgttttagatcaagccgcaaagaatttattaagccaagagcttatt
tacactgcgattacacgcgctaaaaaagtagtgagtcttttggttcatcctgaagcttta
ctacagtcctttacaattcgtacgacacgaaaaagtggtttagttcagaaagttaatcga
ttagttcgttaa

DBGET integrated database retrieval system