KEGG   Acinetobacter oleivorans: AOLE_17775Help
Entry
AOLE_17775        CDS       T01263                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:acd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:acd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acd00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:acd00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:acd00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3790400..3791194)
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANAKQLIEEFKQLLQQNEIADESCHVGVAPVSIALAMVQT
QLQDAAKTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDLLGDNVEIL
KAKLQNSLNAGLTVIYCVGESLEQREQDLAEQVVLQQICDIAPVVSAEQWQKQIVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLSQITSAGPDIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVHAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggcaactggaaaatgaacccaatgcgt
gccaatgccaaacaacttatagaagaatttaaacaactattgcaacaaaacgaaattgca
gatgaaagctgccatgtcggagttgctccggtttctattgcacttgcaatggtacaaaca
caattgcaagatgctgcaaaaacagtatatacagttgcacaagatgtatcgcgtgtagca
ggtacaggcgcctatactggtgaagtcagtgcagaattattaaaagatagccaaattaat
tttgtattggtgggtcactctgaacgccgtgatttgttaggtgataacgttgaaattttg
aaggcaaaactccaaaattctttaaatgcaggcttaactgtcatttattgtgtgggtgaa
agtctcgaacaacgtgaacaagatttggcagagcaggttgtattgcaacaaatctgtgat
atagctcctgtagtgagtgcagagcaatggcaaaagcaaattgtaattgcttatgagcca
atctgggcaattggtacaggtaaaactgcttcaccacaagatgcacaggcaatgcatgct
aaaatccgtgaaggtttaagtcagattacttctgcgggtccagacattgcgattttatat
ggcggtagtgtaaaagctgagaatgcagtcgagttggcagcatgtccagatattaatggc
gcgttggttggaggtgcttcgttaaatgcagcatctttttatcaaatcgtacatgccttt
gcacaaagtaaataa

DBGET integrated database retrieval system