KEGG   Acinetobacter oleivorans: AOLE_18090Help
Entry
AOLE_18090        CDS       T01263                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
acd  Acinetobacter oleivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:acd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3856749..3857516)
Genome map
AA seq 255 aa AA seqDB search
MLFINTRPDSRAAELTDALQNEGYQVESLPLLELVAKPFSEHLLQLYQQLVKAQAIVVVS
PTAVDVGMQYLIQSGLKLDDLTHIQWIAVGQATANRLHEYGVDAHIPDVETSEGMLNLPI
LHNMKQDGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYHRQCPETSYSTFKHLTQNSNY
NLHKWLVLITSEASWKYWLELCLKNNVQPDCVYLVLGPRLFQIVKEYRDQQQAHFHIIQL
ENLSPSGMIHHIQAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttattaatactcgacctgattctcgtgcagctgaattaacagatgctttgcaa
aatgaaggttatcaggttgagtctttacctcttttagaactcgttgctaaacccttttcc
gaacacttacttcagctttaccaacaattagttaaagcacaagctattgttgtggtcagc
ccaactgctgttgatgtgggtatgcagtatttaatacaaagtggtttaaagctagatgac
ttaacacatattcagtggattgcggtcggacaggctaccgctaatcgtcttcatgagtat
ggcgttgacgcacatattccagatgtggaaacttctgagggaatgttaaacctaccgatt
cttcataatatgaaacaggacggtagtgtcgctttctggcgaggagagggtggccgtcaa
tttatgatggaaactttacagcagcaaggcattcagattttaaatttcgttttatatcat
cggcaatgcccagaaacctcatattctacattcaaacatctgacacagaattcaaattat
aatttacataaatggctggtcttaattaccagtgaggccagctggaaatattggttagag
ctttgtttaaaaaataatgtacaacctgattgtgtatatttggttttaggaccacgtctt
tttcaaattgttaaagaatatcgcgatcaacaacaggctcattttcacattattcaactt
gaaaatttatcgccttcggggatgattcatcacattcaggcattataa

DBGET integrated database retrieval system