KEGG   Acinetobacter oleivorans: AOLE_18205Help
Entry
AOLE_18205        CDS       T01263                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
acd  Acinetobacter oleivorans
Brite
Enzymes [BR:acd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AOLE_18205
Secretion system [BR:acd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AOLE_18205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3879091..3879906
Genome map
AA seq 271 aa AA seqDB search
MSFTRSQIFLACTLASSLLFSACSKENKPQKEDALTATAPATGEASTIIERNDKQRLIET
LQKQFKNANINAKILDIKPTEVPNLYWVNLEGMTSIYTTSDGKYLIQGDVIRLGGKELHN
IGDNLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFTDASCPYCHKLHEHIPEINEK
GIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFSQAVQGVNIPPAQCKNPVREQYQLGLNM
GVNGTPAIYSVDGEYLGGYLTPDELIKRLDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttacccgctctcaaatttttcttgcctgcactctggcatctagccttttgttc
agtgcttgttctaaagaaaacaaaccacaaaaagaagatgcgctcacagcgactgcacct
gctactggggaagcttcaaccattatcgaacgtaatgataagcagcgtttaattgaaact
ttgcagaaacaatttaagaatgcaaatatcaatgccaaaattttagatatcaagccgaca
gaagttcctaatttgtattgggtaaatctcgaagggatgacatcgatttatacaaccagt
gatggaaaatatttaattcagggtgatgtaatccgattaggaggcaaagagcttcataat
attggagataatcttcaagcttcagaaaataaaaagcatcttgctgcgttaaaaaatgaa
gatttgattgtttacccagcgaaaggcggtaaagctaaacatgtgatttatgtgtttacc
gatgcaagctgtccttattgccataaactacatgagcacatacctgaaattaatgaaaag
ggtattgaagtacgctatatcgcttggccacgtggtgagcaatttatgccgaccatggaa
gctgtatggtgtagtgcagatcgtaaagctgcctttagccaagcagtacaaggtgtcaat
attccgcctgctcaatgtaaaaaccctgttcgtgaacaatatcaacttggcttaaacatg
ggtgtaaatggtacacctgctatttatagtgttgatggcgagtacttaggtggatatcta
acaccagatgaattaattaaacgtctggataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system