KEGG   Acinetobacter oleivorans: AOLE_18215Help
Entry
AOLE_18215        CDS       T01263                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOLE_18215
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOLE_18215
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AOLE_18215
Enzymes [BR:acd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AOLE_18215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3881506..3882645
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVIYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVESPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMSQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacaccccactcattaaacttgag
aatattccacgtattattggcaaagatgttgaaatttatgtgaaatatgagggcttaaac
ccaactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcggttgaagaa
ggctctaaagcgattatctgtgcatctacgggtaacacttctgctgctgctgctgcttat
gctgcacgcgcaggtatcaaagcatttgttttgattccagaaggcaaaattgcaatgggt
aaaatggcgcaagcgatgatgtatggtgcaatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagttgctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaaccattgcttatgaaatcgttgaagcttta
ggccgcgcacctgattatcactgcttacctgttggtaatgcaggtaacatcactgctcac
tggatgggttataccgaagctgtagcaaaccaacctgctgatcagtttgaacaagtgatt
tatgatgcagctactgatcaattcactggtccaaaacctgaaggtttaccaacaatggtt
ggttaccaagcttctggcgcagctccattcttacgtggtgctccagttgaaagccctgaa
acagttgcaactgcaatccgtattggtaatccacaaagctggaaccatgcaaaagctgta
gtacgtgactctaaaggctggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggcgtatttgttgagccagcatctgctgcttctattggc
ggtgcgattcgcgatattaaagcaggtaagattgctgaaggttctgtcattgtatgtaca
gtaactggtaatggcttgaaagatcctgatactgcaatcaaacaatgtgctgatgcagtg
atgttgtcaattgatgcgacaatgagccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system