KEGG   Acinetobacter oleivorans: AOLE_18215Help
Entry
AOLE_18215        CDS       T01263                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AOLE_18215
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOLE_18215
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AOLE_18215
Enzymes [BR:acd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AOLE_18215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3881506..3882645
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVIYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVESPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMSQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacaccccactcattaaacttgag
aatattccacgtattattggcaaagatgttgaaatttatgtgaaatatgagggcttaaac
ccaactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcggttgaagaa
ggctctaaagcgattatctgtgcatctacgggtaacacttctgctgctgctgctgcttat
gctgcacgcgcaggtatcaaagcatttgttttgattccagaaggcaaaattgcaatgggt
aaaatggcgcaagcgatgatgtatggtgcaatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagttgctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaaccattgcttatgaaatcgttgaagcttta
ggccgcgcacctgattatcactgcttacctgttggtaatgcaggtaacatcactgctcac
tggatgggttataccgaagctgtagcaaaccaacctgctgatcagtttgaacaagtgatt
tatgatgcagctactgatcaattcactggtccaaaacctgaaggtttaccaacaatggtt
ggttaccaagcttctggcgcagctccattcttacgtggtgctccagttgaaagccctgaa
acagttgcaactgcaatccgtattggtaatccacaaagctggaaccatgcaaaagctgta
gtacgtgactctaaaggctggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggcgtatttgttgagccagcatctgctgcttctattggc
ggtgcgattcgcgatattaaagcaggtaagattgctgaaggttctgtcattgtatgtaca
gtaactggtaatggcttgaaagatcctgatactgcaatcaaacaatgtgctgatgcagtg
atgttgtcaattgatgcgacaatgagccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system