KEGG   Acinetobacter oleivorans: AOLE_18215Help
Entry
AOLE_18215        CDS       T01263                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acd  Acinetobacter oleivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acd00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:acd00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3881506..3882645
Genome map
AA seq 379 aa AA seqDB search
MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRIIGKDVEIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGIKAFVLIPEGKIAMG
KMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEAL
GRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVIYDAATDQFTGPKPEGLPTMV
GYQASGAAPFLRGAPVESPETVATAIRIGNPQSWNHAKAVVRDSKGWFDELQDSEILEAQ
RLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCADAV
MLSIDATMSQVKDSILSNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgccaatcgttatactggtcttgtagatcgttatcgtgaccgtttgccagtt
tcggcaactactcgtgctatctctttgggtgaaggcaacaccccactcattaaacttgag
aatattccacgtattattggcaaagatgttgaaatttatgtgaaatatgagggcttaaac
ccaactggttcatttaaagaccgtggtatgaccatggctgtaaccaaagcggttgaagaa
ggctctaaagcgattatctgtgcatctacgggtaacacttctgctgctgctgctgcttat
gctgcacgcgcaggtatcaaagcatttgttttgattccagaaggcaaaattgcaatgggt
aaaatggcgcaagcgatgatgtatggtgcaatcactatgcaaattcgtggtaacttcgat
gatggtatgcgtcttgtaaaagaagttgctgatcaagcacctgtaacgattgtaaactca
atcaacccttaccgtttgcaaggtcaaaaaaccattgcttatgaaatcgttgaagcttta
ggccgcgcacctgattatcactgcttacctgttggtaatgcaggtaacatcactgctcac
tggatgggttataccgaagctgtagcaaaccaacctgctgatcagtttgaacaagtgatt
tatgatgcagctactgatcaattcactggtccaaaacctgaaggtttaccaacaatggtt
ggttaccaagcttctggcgcagctccattcttacgtggtgctccagttgaaagccctgaa
acagttgcaactgcaatccgtattggtaatccacaaagctggaaccatgcaaaagctgta
gtacgtgactctaaaggctggttcgatgaacttcaagacagcgaaattttagaagctcaa
cgcttactttctatgtatgaaggcgtatttgttgagccagcatctgctgcttctattggc
ggtgcgattcgcgatattaaagcaggtaagattgctgaaggttctgtcattgtatgtaca
gtaactggtaatggcttgaaagatcctgatactgcaatcaaacaatgtgctgatgcagtg
atgttgtcaattgatgcgacaatgagccaagtaaaagattcgattttatctaatatgtaa

DBGET integrated database retrieval system