KEGG   Acinetobacter oleivorans: AOLE_18265Help
Entry
AOLE_18265        CDS       T01263                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AOLE_18265
   00240 Pyrimidine metabolism
    AOLE_18265
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AOLE_18265
   03430 Mismatch repair
    AOLE_18265
   03440 Homologous recombination
    AOLE_18265
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_18265
DNA replication proteins [BR:acd03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_18265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3894297..3894704
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILQKHPKIWWYCPDMQLQQMLDERLWEFDPVSFI
AHGVDQTDAAVCISAKQPLEQGLLVFNFNNHALEQVDHFSHIIEIVENNETAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagtttttatctgtttgaaaccagcgaagaacggcaagtcgatagtgct
tgccgtttatgtcgaaaaatattacagaagcatcctaaaatctggtggtattgcccagat
atgcagctacaacagatgcttgatgaaagattatgggaattcgaccctgtcagtttcatt
gcgcatggcgttgaccagactgatgctgctgtatgtatttcggctaaacaaccacttgaa
caaggcctgttagtatttaattttaacaatcatgcacttgaacaagttgatcattttagc
cacattatagaaattgttgaaaataatgaaacagccaagcaaattggtcgagaaaaattt
aaaatgtatcgccgtttgggtatagaaccgcggacctttaaattataa

DBGET integrated database retrieval system