KEGG   Acinetobacter oleivorans: AOLE_18335Help
Entry
AOLE_18335        CDS       T01263                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acd  Acinetobacter oleivorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AOLE_18335
Enzymes [BR:acd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     AOLE_18335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3905670..3906446
Genome map
AA seq 258 aa AA seqDB search
MKTASVNKQELMQHAQQDMQKWISDSNLTDRQKLALTCRILFDHGHDAGLAGQITCRSES
KESFITQRFGLGFDEITASNLLEVNQDLEPIHQEGMANPANRFHTWIYKEHPEVNCIIHT
HPTHVAALSMLQIPLIISQMDVCALYEDCSFVGHWPGVPVGNEEGILISSALGKNRAVLL
SHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIPHDLATEAHDWVSTDKRNK
VNFAYYARKALKKHSDCI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcttctgtaaataaacaagagctgatgcaacacgcacagcaagacatgcaa
aagtggataagcgactcaaatttaactgatcgccaaaagcttgctctcacttgtcgtatt
ttatttgatcatggccatgatgctggtttagcaggccaaattacttgtcgtagtgaaagt
aaagaatcctttattacccaacgttttggtttaggttttgatgaaattactgcctcaaac
ttgcttgaggtgaatcaagacttagaacctatccatcaagaaggtatggcaaacccagcc
aaccgttttcatacatggatttataaagaacacccagaggtgaactgcattatccatacg
catccgactcatgtagcggctctttccatgcttcaaattccgctcataatttctcaaatg
gatgtctgcgcactctacgaagattgctcatttgtaggccattggccaggtgttcctgtg
ggcaatgaagaaggtattttgatctcttctgctttgggtaaaaaccgtgctgttttgtta
tctcaccatggtcaactggtcacaggaaaaaccattgaagaagcatgtaacttggctctt
ttaattgaacgcgcagctcaactgcaacttttagccatgtcggccgggcaaattcagccg
atcccacacgatttagctacagaagctcatgactgggtatctaccgataaacgtaacaaa
gtgaactttgcttactacgcacgtaaagctttgaaaaaacattctgactgtatttaa

DBGET integrated database retrieval system