KEGG   Acinetobacter oleivorans: AOLE_19070Help
Entry
AOLE_19070        CDS       T01263                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acd  Acinetobacter oleivorans
Pathway
acd00040  Pentose and glucuronate interconversions
acd00052  Galactose metabolism
acd00500  Starch and sucrose metabolism
acd00520  Amino sugar and nucleotide sugar metabolism
acd01100  Metabolic pathways
acd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOLE_19070
   00052 Galactose metabolism
    AOLE_19070
   00500 Starch and sucrose metabolism
    AOLE_19070
   00520 Amino sugar and nucleotide sugar metabolism
    AOLE_19070
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AOLE_19070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADI92696
UniProt: D8JJ73
Position
complement(4065414..4066289)
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVDAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPPHVSVVSVRQPQPLGLGHAVLCAKSIV
GQDNFAVLLPDVLVKDDSGRNDLSRMIARYNTIQAAQIMVEAVPDNLVDQYGIVDVAHTP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QETDIVEAYRMQGQTFDCGSKLGYLKAVLHYGIQHPKLGPEFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaagcagttttaccagtagctggtttaggtacacgttttttaccagcaagt
aagtcaattccaaaagaaatggtaacagttgttgaccgtccagctattgaatatgtagtg
cgtgaagcagttgatgctggaattgagcaaattattttggtgactcactcttcaaaagca
tcgattgaaaattattttgatcgaaactttgaattagaaactacattagagcaaaaaaag
aaatttgatttacttgcagaaattacacaaattgttccgccccatgtgagtgttgtaagt
gtaagacaacctcagcctttaggtttaggacatgcggttttatgtgcaaagagtattgtt
ggtcaagataattttgctgtgttattaccggatgttttggtgaaagacgactcgggccga
aatgatttatctcgtatgattgcacgttataatacaattcaagctgcacagattatggta
gaagcagtacctgataaccttgtggatcaatacgggattgtagatgtagcgcatactcct
aatgagggtgaaagtattgctatgcaaggcattgttgaaaaacctgctgttggctctgca
ccttctaatctttctgtagttggtcgctacgttttgcctgcaaaaattatgcagcttttg
gaaaacacacccaaaggtgcaggtaatgaaattcagttaacagatgcgattgcgatgtta
caagaaacagatattgttgaagcctatcgtatgcaaggccaaacatttgactgtggtagt
aaacttggatatttaaaagctgtactacattatggaattcaacatcctaaattaggccca
gaatttaaacagctaattcaagagcttaagttgtag

DBGET integrated database retrieval system