KEGG   Acinetobacter oleivorans: AOLE_19070Help
Entry
AOLE_19070        CDS       T01263                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acd  Acinetobacter oleivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:acd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOLE_19070
   00052 Galactose metabolism
    AOLE_19070
   00500 Starch and sucrose metabolism
    AOLE_19070
   00520 Amino sugar and nucleotide sugar metabolism
    AOLE_19070
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AOLE_19070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4065414..4066289)
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVDAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPPHVSVVSVRQPQPLGLGHAVLCAKSIV
GQDNFAVLLPDVLVKDDSGRNDLSRMIARYNTIQAAQIMVEAVPDNLVDQYGIVDVAHTP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QETDIVEAYRMQGQTFDCGSKLGYLKAVLHYGIQHPKLGPEFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaagcagttttaccagtagctggtttaggtacacgttttttaccagcaagt
aagtcaattccaaaagaaatggtaacagttgttgaccgtccagctattgaatatgtagtg
cgtgaagcagttgatgctggaattgagcaaattattttggtgactcactcttcaaaagca
tcgattgaaaattattttgatcgaaactttgaattagaaactacattagagcaaaaaaag
aaatttgatttacttgcagaaattacacaaattgttccgccccatgtgagtgttgtaagt
gtaagacaacctcagcctttaggtttaggacatgcggttttatgtgcaaagagtattgtt
ggtcaagataattttgctgtgttattaccggatgttttggtgaaagacgactcgggccga
aatgatttatctcgtatgattgcacgttataatacaattcaagctgcacagattatggta
gaagcagtacctgataaccttgtggatcaatacgggattgtagatgtagcgcatactcct
aatgagggtgaaagtattgctatgcaaggcattgttgaaaaacctgctgttggctctgca
ccttctaatctttctgtagttggtcgctacgttttgcctgcaaaaattatgcagcttttg
gaaaacacacccaaaggtgcaggtaatgaaattcagttaacagatgcgattgcgatgtta
caagaaacagatattgttgaagcctatcgtatgcaaggccaaacatttgactgtggtagt
aaacttggatatttaaaagctgtactacattatggaattcaacatcctaaattaggccca
gaatttaaacagctaattcaagagcttaagttgtag

DBGET integrated database retrieval system