KEGG   Acinetobacter oleivorans: AOLE_19440Help
Entry
AOLE_19440        CDS       T01263                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
acd  Acinetobacter oleivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4145954..4146652)
Genome map
AA seq 232 aa AA seqDB search
MLKKLGILALFSLTASMSFANVDTVRENIKKQYPNLKISNIQKTEMSGLYSANLDQQIIY
VGEDGQHMLVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIQQGVKPT
VASCANPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaaattaggaatattggcgttatttagcttaactgcaagtatgagtttcgct
aatgtggatactgttagggaaaatattaagaaacaatatcctaatttgaaaattagcaat
attcagaaaaccgaaatgtcagggctatatagcgctaatctcgatcagcaaatcatttat
gttggcgaagatgggcagcatatgcttgttggttctatgattcgattaaaagatcagaag
aatttgaccaaagatctggtgttaggacagaactcaattgattggaaacaattaccttta
aaagatgcaattaaaacggttaaaggtaatggacagcatgttctagccgtattttctgat
ccaaactgcccttattgcaaacaacttgaacctgaactcgataagctgaaagatgtgacc
atttacacgttcatctatcctttaaaacctcagtctattgttgtttctagacaggtttgg
tgtgcaccaaatcaatcctattcatggaaaaaactgattcagcaaggtgttaaaccaaca
gttgcaagctgtgctaatccaattgaccgtaatttagagcttggaaagaaactaggtttt
aatggtacccctaccttaatttttgcaaatggatttaaactggtaggcgctcgatctgcc
gaagaaattcaggcagtgtggaaagaattaggtctataa

DBGET integrated database retrieval system