KEGG   Acidothermus cellulolyticus: Acel_0075Help
Entry
Acel_0075         CDS       T00426                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00010  Glycolysis / Gluconeogenesis
ace00260  Glycine, serine and threonine metabolism
ace00680  Methane metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
ace01230  Biosynthesis of amino acids
Module
ace_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0075
  Energy metabolism
   00680 Methane metabolism
    Acel_0075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_0075
Enzymes [BR:ace01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Acel_0075
Membrane trafficking [BR:ace04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Acel_0075
Exosome [BR:ace04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Acel_0075
  Exosomal proteins of melanoma cells
   Acel_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABK51851
JGI: Acel0075
UniProt: A0LQZ1
Position
79933..80691
Genome map
AA seq 252 aa AA seqDB search
MRDGQPGALILLRHGESEWNATNQFTGWVDVDLSPKGEQEAAAAGRMLAERAERPDIVHT
SVLRRAIRTANIALDAAGWSWLPVRRSWRLNERHYGALQGKDKKATLQAFGEEQFMLWRR
SYDVPPPPIADDDPYAQTGDPRYAELPAELLPKTECLKDVVVRLLPYWYDAIVPDLLAGK
DVLVVAHGNSLRALVKHLDQMSDADVVGLNIPTGIPLVYRFDATLRPQVRGGEYLDPEAA
AAAAAAVANQGR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatggacaacccggagccctcatcttgttgcggcatggcgaaagcgagtggaac
gccaccaatcagttcaccggttgggtcgacgtcgacctgtcgccgaagggagagcaggag
gctgcggcggccggccggatgttggctgagcgcgccgagcgccccgacatcgttcacacc
tcggtgttgcgccgcgccatccggacggcgaatatcgccttggacgccgccggctggtcg
tggctgccggttcgccggagttggcggctgaacgagcggcactatggcgcgctgcagggc
aaggacaaaaaagccaccctgcaggctttcggcgaggagcaattcatgctctggcggcgg
tcctacgacgtgccgccgccgccgatcgcggacgacgatccgtacgcgcagaccggggat
ccccgctatgccgagctgccggccgaattgttaccgaagaccgagtgcctcaaggacgtc
gttgtgcggctcctgccgtactggtatgacgccatcgtgccggatctgctcgccggcaag
gacgtcctcgtcgtggctcacgggaattcgttgcgggcgctggtcaaacacctcgaccag
atgtcggacgccgacgtcgtcggactgaacattcccaccggcattccgctcgtgtaccgc
tttgacgcaacgctgcgtccgcaggtccgcggcggggaatacctcgatcccgaagcggcg
gcggccgcggcagcggccgtcgccaatcaaggccgatag

DBGET integrated database retrieval system