KEGG   Acidothermus cellulolyticus: Acel_0075Help
Entry
Acel_0075         CDS       T00426                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_0075
   01230 Biosynthesis of amino acids
    Acel_0075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0075
  Energy metabolism
   00680 Methane metabolism
    Acel_0075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_0075
Enzymes [BR:ace01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Acel_0075
Exosome [BR:ace04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Acel_0075
  Exosomal proteins of melanoma cells
   Acel_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
79933..80691
Genome map
AA seq 252 aa AA seqDB search
MRDGQPGALILLRHGESEWNATNQFTGWVDVDLSPKGEQEAAAAGRMLAERAERPDIVHT
SVLRRAIRTANIALDAAGWSWLPVRRSWRLNERHYGALQGKDKKATLQAFGEEQFMLWRR
SYDVPPPPIADDDPYAQTGDPRYAELPAELLPKTECLKDVVVRLLPYWYDAIVPDLLAGK
DVLVVAHGNSLRALVKHLDQMSDADVVGLNIPTGIPLVYRFDATLRPQVRGGEYLDPEAA
AAAAAAVANQGR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatggacaacccggagccctcatcttgttgcggcatggcgaaagcgagtggaac
gccaccaatcagttcaccggttgggtcgacgtcgacctgtcgccgaagggagagcaggag
gctgcggcggccggccggatgttggctgagcgcgccgagcgccccgacatcgttcacacc
tcggtgttgcgccgcgccatccggacggcgaatatcgccttggacgccgccggctggtcg
tggctgccggttcgccggagttggcggctgaacgagcggcactatggcgcgctgcagggc
aaggacaaaaaagccaccctgcaggctttcggcgaggagcaattcatgctctggcggcgg
tcctacgacgtgccgccgccgccgatcgcggacgacgatccgtacgcgcagaccggggat
ccccgctatgccgagctgccggccgaattgttaccgaagaccgagtgcctcaaggacgtc
gttgtgcggctcctgccgtactggtatgacgccatcgtgccggatctgctcgccggcaag
gacgtcctcgtcgtggctcacgggaattcgttgcgggcgctggtcaaacacctcgaccag
atgtcggacgccgacgtcgtcggactgaacattcccaccggcattccgctcgtgtaccgc
tttgacgcaacgctgcgtccgcaggtccgcggcggggaatacctcgatcccgaagcggcg
gcggccgcggcagcggccgtcgccaatcaaggccgatag

DBGET integrated database retrieval system