KEGG   Acidothermus cellulolyticus: Acel_0138Help
Entry
Acel_0138         CDS       T00426                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Acel_0138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0138
  Lipid metabolism
   00071 Fatty acid degradation
    Acel_0138
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acel_0138
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acel_0138
   00626 Naphthalene degradation
    Acel_0138
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acel_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
142163..143176
Genome map
AA seq 337 aa AA seqDB search
MRAWVVHRPRRYDPAAWRTEHPLVRTEKPDPLPGPHEIRIRVSACGVCRTDLHLAEGDLP
PRRPDTLPGHEIVGTVDMVGTECQRFAAGDRVGIAWLRYTCGECRWCLRHRENLCPSARF
TGWDADGGYAEFAVVDERFAYRIPDTFDDEHAAPLLCAGIIGFRALRLADCPPGGRLGIY
GFGASAHLAAQVARHQGADIYVFTRSAHGKELARELGASFVGDPNTPPPQPLDAAVIFAP
SGDIVPAALAALDRGGTVAIAGIHLTAIPQLDYVDALFGERVLRSVTANTRADGEEFLRI
AAEAKVVVATSPYPFDAADRALTDLAAGRVRGAAVLC
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgtgggtggttcaccggccgcgtcgctacgacccggcggcgtggcgcactgag
catccgctcgttcgcaccgaaaagcccgacccgcttcccggccctcatgagatccgcatt
cgggtcagcgcgtgcggcgtatgccggacggacctccacctggccgaaggcgatctcccg
ccgcggcggcccgacacgctacccgggcacgagattgtcggcactgtcgacatggtcggc
accgagtgtcaacgcttcgcagcgggagatcgcgtcggcatcgcgtggttgcgctacacc
tgcggcgaatgccggtggtgcctgcgccatcgggagaacctctgcccgtcggcccgattc
accggctgggacgccgacggcggttacgctgagttcgctgttgtcgacgagcggtttgcc
taccgaatcccggacaccttcgacgacgaacacgccgcaccgctcctctgcgcgggcatc
atcggctttcgtgctctccgcctggcggactgccctcccggcggacgcctcggcatttac
ggctttggggcttcggcgcacctggccgcacaggttgcccggcatcaaggggctgacatt
tacgtcttcactcgctcggcgcacggaaaggagctggcccgcgaactcggggcgtccttc
gtcggagaccccaacacgccgccgccgcaaccgttggacgctgcggtaatcttcgcgccg
tccggcgacattgttcctgcggcactggctgcactggaccggggcggcaccgtcgccatt
gcgggtattcacctcacggcgataccgcaactggactatgtcgacgcgctcttcggtgag
cgggtgttgcgctccgtcactgcgaacactcgggcggacggtgaagagtttctccggatc
gcggccgaagccaaggttgtcgtggcaacgtcgccgtatccgttcgacgctgctgaccgt
gcgctcaccgatctggccgccggccgggtccgcggggccgccgttctctgttga

DBGET integrated database retrieval system