KEGG   Acidothermus cellulolyticus: Acel_0166Help
Entry
Acel_0166         CDS       T00426                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ace  Acidothermus cellulolyticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acel_0166
   00052 Galactose metabolism
    Acel_0166
   00500 Starch and sucrose metabolism
    Acel_0166
   00520 Amino sugar and nucleotide sugar metabolism
    Acel_0166
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acel_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
173873..174781
Genome map
AA seq 302 aa AA seqDB search
MATSVRRVRKAVIPAAGLGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLDDILMI
TGRNKRPLEDHFDRNYELESALAAKGDDRKLALVEESTRLATIHYVRQGEPRGLGHAVSC
AAMHVGEEPFAVLLGDDIIDGRDPLLPRMIDVLQRRGGTVIALMEVDPDHIHLYGCAAVE
PTDEPDVVRVTDLVEKPRERAPSNLALIGRYVIAPEIFDVLAKTEPGAGGEIQLTDALRV
LAGRDGDGGPVHGVLFRGRRYDTGDRLEYLRAVIQLAVEREDLGPPLLSWLREFVDARRD
DR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagcgttcgacgagttcgcaaagcggtgattccggctgccgggctgggcacg
cgctttctccccgcgaccaaggcgaccccgaaggagatgctgccggtcgtcgacaaaccg
gcgatccagtacgtcgtcgaggaggcggtcgcggccggactcgacgacatcctgatgatc
accggtcggaacaagcgcccgctggaagaccacttcgaccgcaactacgaactcgaatcg
gcgctggccgccaagggtgacgaccgcaagctcgccctcgttgaagagtcgacgcggctg
gccaccatccactacgtccggcagggggaaccgcgcgggttggggcacgccgtctcgtgc
gccgccatgcacgtcggcgaggagccgttcgccgtcctgctcggcgacgacatcatcgac
ggccgcgacccgctgttgcctcgcatgattgacgtcttgcaacggcgcggcggcaccgtc
atcgcgctgatggaagtcgatcccgaccacattcacctctacggatgcgcggcggtggag
ccgaccgatgaaccggacgtcgtccgggtgacggatctggtggagaagccgcgggaacgg
gcgccgagcaatctcgccctcatcgggcggtacgtcattgccccggagatattcgacgtt
ctggcgaaaaccgaaccgggggccggcggcgaaattcagctcaccgacgcgctccgggtt
ctcgccggccgagacggcgacggcgggcccgtgcacggtgtcctcttccgcggccggcgt
tacgacaccggggaccggttggaatatctgcgtgcggtgattcagcttgctgttgagcgc
gaggaccttgggccgccgcttctttcgtggctgcgagaattcgtggacgcccgacgagac
gaccgatga

DBGET integrated database retrieval system