KEGG   Acidothermus cellulolyticus: Acel_0180Help
Entry
Acel_0180         CDS       T00426                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ace  Acidothermus cellulolyticus
Brite
Enzymes [BR:ace01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Acel_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
190901..192937
Genome map
AA seq 678 aa AA seqDB search
MHHAMRRMVTSASVVGVATLAAATVLITGGIAHAASTLKQGAEANGRYFGVSASVNTLNN
SAAANLVATQFDMLTPENEMKWDTVESSRGSFNFGPGDQIVAFATAHNMRVRGHNLVWHS
QLPGWVSSLPLSQVQSAMESHITAEVTHYKGKIYAWDVVNEPFDDSGNLRTDVFYQAMGA
GYIADALRTAHAADPNAKLYLNDYNIEGINAKSDAMYNLIKQLKSQGVPIDGVGFESHFI
VGQVPSTLQQNMQRFADLGVDVAITELDDRMPTPPSQQNLNQQATDDANVVKACLAVARC
VGITQWDVSDADSWVPGTFSGQGAATMFDSNLQPKPAFTAVLNALSASASVSPSPSPSPS
PSPSPSPSPSPSPSPSPSPSPSPSSSPVSGGVKVQYKNNDSAPGDNQIKPGLQVVNTGSS
SVDLSTVTVRYWFTRDGGSSTLVYNCDWAVMGCGNIRASFGSVNPATPTADTYLQLSFTG
GTLPAGGSTGEIQSRVNKSDWSNFTETNDYSYGTNTTFQDWSKVTVYVNGRLVWGTEPSG
TSPSPTPSPSPTPSPSPSPSPSPSPSPSPSPSPSPSSSPSSGCVASMRVDSSWPGGFTAT
VTVSNTGGVSTSGWQVGWSWPSGDSLVNAWNAVVSVTGTSVRAVNASYNGVIPAGGSTTF
GFQANGTPGTPTFTCTTS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcatcacgcgatgcgaagaatggtgacgtcggccagtgtcgtcggcgtcgctacgctt
gccgccgccaccgttttgatcacaggcggcatcgcccacgctgcgtccaccttgaaacag
ggggcggaggcgaacggccgctacttcggcgtatcggcgagcgtcaatacactgaacaac
tcagctgccgctaacctggtcgccacgcaattcgacatgctaacgcctgagaacgaaatg
aagtgggacaccgtcgagtcgtcgagaggatccttcaatttcggtccaggcgatcagatc
gtcgctttcgccactgcacacaacatgcgggtccgtggtcacaacctggtctggcacagc
cagctgcccggatgggtgtcgagcctgccgctgagccaggttcagtcggccatggagtca
cacatcacggctgaagtgacgcactacaagggcaaaatatacgcctgggacgtagtgaac
gaaccgttcgacgacagcggcaatctccgcaccgatgttttctatcaagcgatgggagcg
ggctacatcgccgacgccctgcggaccgcccacgccgccgatccaaacgcgaagctctac
ctcaacgactacaacatcgagggtatcaacgccaagagcgacgcgatgtacaacttgatt
aagcaactgaagagccagggcgtgcccatcgacggcgtcggcttcgagagccacttcatt
gtcgggcaggttccgtcgaccctgcagcaaaacatgcagcgcttcgcggacctcggcgtt
gacgtcgccatcaccgagctcgacgaccggatgccgactccaccttcgcagcagaatctc
aaccagcaggcgacagatgacgccaatgtcgtcaaggcctgccttgcggttgcacgctgt
gtcggcatcactcagtgggacgtcagcgacgcggactcgtgggtgcccggcaccttctcg
ggtcagggtgcagcgacaatgttcgacagcaatcttcagccaaagccagccttcaccgcc
gtcttgaacgcgctcagtgcaagtgcgtcggtgtcgccgtctccgtcgccgtcgccgagt
ccgtcgccgagtccgtcgccgagtccgtcgccgagcccatccccgtcgccgagcccgtct
ccgtcgccgtcttcgtcgccggtgtcgggtggggtgaaggtgcagtataagaacaatgat
tcggcgccgggtgataatcagatcaaaccgggtttgcaggtggtgaataccgggtcgtcg
tcggtggatttgtcgacggtgacggtgcggtactggttcacccgggatggtgggtcgtcg
acactggtgtacaactgtgactgggccgtgatggggtgtgggaatatccgcgcctcgttc
ggttcggtgaacccggcgacgccgacggcggacacctacttgcagttgtcgttcaccggc
ggcaccttgccggctggtgggtcgacgggtgagattcaaagccgggtgaataagagtgac
tggtcgaatttcaccgagacgaatgactactcgtatgggacgaacaccaccttccaggat
tggtcgaaggtgacggtgtacgtcaatggccggttggtgtgggggactgaaccgtccggc
accagccccagcccgacaccgtccccgagcccgacaccgtccccgtccccgagcccgagc
ccgtcgccgtctccgagtccgtcgccgagtccgtcgccgagtccgagcagctcgccgtcg
tctgggtgtgtggcgagtatgcgggtggacagtagttggccgggcgggtttaccgccacg
gtgacggtgagtaataccggtggggtgtcgaccagtggttggcaggtcgggtggagttgg
ccgtcgggtgacagtctggtcaacgcgtggaatgcggtggtgtcggtgaccgggacgtcg
gtgcgggcggtcaatgcctcctacaacggggtgattcccgcgggtgggtcgacgacgttc
gggttccaggccaacggcacacccggcaccccgacctttacctgcaccacctcctga

DBGET integrated database retrieval system