KEGG   Acidothermus cellulolyticus: Acel_0207Help
Entry
Acel_0207         CDS       T00426                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ace  Acidothermus cellulolyticus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ace00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
221876..222805
Genome map
AA seq 309 aa AA seqDB search
MHRSRRSAAAGSSPRDEGADLPVNTSAAYGELLGFPDIGRCRVMGVLNVTPDSFSDGGQW
FETDKAIAHGVDLFRNGADIVDVGGESTRPGALRVDPAEELRRVLPVVRELAAVGPVSID
TMRADVAEAAVDAGAVLVNDVSGGLADPRMIPFIAANRLPYVVMHWRGPSVDMQSRAHYD
DIVADVRREISARIDAVLAAGGDFRQIIVDPGIGFAKRPDTDHNWALLKHLDQLGSLGRP
VLVGASRKAFLGRLLAGPDGTPRPPMLRDHASSAITALVAAAGAWAVRVHAVEADADAVR
VAARWRAQP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcatcggagtcgacggtccgcggccgccggatcgtcacccagggacgaaggagcggac
cttccggtgaacacctcggcggcgtacggcgaattgctcggtttcccggacatcggcagg
tgccgggtcatgggcgtcttgaacgtcaccccggattcgttctccgacggcggccaatgg
ttcgagacggacaaggcgatcgcccacggcgtcgacctgttccgtaacggtgccgacatc
gtcgacgtcggcggtgaatccacccgtccaggggcgttgcgcgtggatccggctgaggag
ctgcgccgagtgctgcccgtagtccgcgagctcgccgccgtcggcccggtgagcattgac
accatgcgcgccgacgtcgccgaagcggcggttgacgccggcgcggtcctcgtcaatgac
gtgagcggcgggttggccgacccgcggatgatcccgttcatcgcggcgaaccggctgccg
tacgtcgtcatgcattggcgcggtcccagcgtcgacatgcaaagccgcgcccattacgac
gacatcgtggccgacgtccggcgggaaatttcggcccgaatcgacgcggtactcgccgcc
ggcggggatttccggcaaatcatcgtcgatccgggaatcggctttgccaagaggccggac
acggaccacaactgggcgctgctcaaacacctcgaccagctcggctcgctgggccggccg
gtgctcgtcggcgcctcgcggaaagctttcctcgggcggctgctcgccgggcccgacgga
acaccacggccgccgatgctccgggaccacgccagctccgcgatcaccgctctggtcgcc
gccgccggggcctgggcggttcgggtccatgcggtagaagccgacgcggacgccgtccgg
gtcgcggcgcggtggcgggcgcagccatga

DBGET integrated database retrieval system