KEGG   Acidothermus cellulolyticus: Acel_0372Help
Entry
Acel_0372         CDS       T00426                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ace  Acidothermus cellulolyticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(384509..385678)
Genome map
AA seq 389 aa AA seqDB search
MRMRSMTAAALGAAMVVATATTAFAHGNPPYHPPADSLRALAAKIGLRVGTAIIPYDLDH
PDYAAIAASQFSVVTPGNEMKWQVVEPTQGTYDWSGGDRLVQFAQEHGQLVRGHTLVWHN
QLPDWLVQGVNNGTISNAQLRDLLHKHIVDEVTHFKGKIWQWDVANEFFANSWDPHPLPD
GINGDDFWVQHLGEGIIADAFRWAHQADPHALLFYNDYNIAGEDGTNAKADAVYNWVKKM
LAEGVPINGIGDQGHLDTQYGFPTKMQEDLQRYADLGLKVAITEADVRTFVTDATTQQPT
DPLAPYAQANYYDGMLKACLAVKNCISYTVWGFGDADSWIPGFFSGEGYANLYDVNLQPK
PAYTALQQTLALAAGAPHRAGFGHHALRR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgcgctcgatgacggcagcggcgctgggcgctgccatggtcgtcgcgacggcc
accacggctttcgcgcacggcaatccgccgtaccacccgccggccgattcgctccgcgcg
ctggctgcgaagataggcctccgcgtcggtaccgccatcattccgtacgacctcgaccat
ccggattacgcggcaatcgccgccagtcaattctcggtcgtcaccccaggcaacgaaatg
aagtggcaggtcgttgaaccgacccaaggtacgtacgattggtccggcggcgatcggctc
gtgcaattcgcgcaagaacacggacagctcgtccgcggccacacgctcgtctggcacaac
cagctccccgactggctggtccagggcgtcaacaacggtacgatttccaacgcgcaattg
cgggacctgctgcacaagcacatcgtggacgaagtcacccatttcaaaggaaagatctgg
caatgggacgtcgcgaatgaattcttcgccaactcctgggacccgcatccactccccgac
ggcatcaacggagacgatttctgggtgcagcatctcggtgagggaatcatcgccgacgcc
ttccgctgggcgcaccaggccgatccgcacgcgctgttgttctacaacgactacaacatc
gccggcgaagacggcacgaacgccaaggccgacgcggtgtacaactgggtgaagaagatg
ctcgccgagggtgtgccgatcaacggcatcggtgaccagggtcacctggacacccagtac
ggcttcccgacaaagatgcaggaggacttgcagcggtacgccgacttgggtctgaaggtg
gcgatcaccgaagcggatgtccgcacctttgtcacggacgcgacaacgcagcaaccgacc
gacccgctcgcgccgtacgcgcaggcgaactactacgacgggatgctcaaggcctgcctc
gccgtcaagaactgcatctcctacacggtctggggattcggggacgcggattcgtggatt
cccggattcttctccggcgaagggtacgcaaatctgtacgacgtgaacctgcagccgaag
ccggcgtacacggccttgcagcagacccttgcgctcgcagccggcgcgccgcaccgggcg
ggattcggtcatcacgccctgcgccgataa

DBGET integrated database retrieval system