KEGG   Acidothermus cellulolyticus: Acel_0573Help
Entry
Acel_0573         CDS       T00426                                 

Definition
RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_0573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0573
   00052 Galactose metabolism
    Acel_0573
   00500 Starch and sucrose metabolism
    Acel_0573
   00520 Amino sugar and nucleotide sugar metabolism
    Acel_0573
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acel_0573
   00524 Butirosin and neomycin biosynthesis
    Acel_0573
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Acel_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
603025..604050
Genome map
AA seq 341 aa AA seqDB search
MSNLSSRTRGDALPTSARHLRLGVDLGATRIKVVVVEIDASGEVALRFSAQYPTAADEGP
SAVAERLARYALDAVAEVGRVVGAGVGIPGLYRASSGEIEFLPNMPGAWRGFRLREYLTT
LWRVPVVLINDARAFTLAEARLGAGKGHQTVVGVTVGTGIGGGLVVDGRLLMGSDGRRGE
VGHQIVEVDGPLCTCGGFGCVEALAGSLALMRATGLASLDEIYAAAERGEKEARAAVARA
AKYLAAGIANVVTLLRPERVVIGGGAASASRLLIASLRDMVARRAALVDAETYEIVAAEL
GPVAGAIGAALWSAEIDSGMCMDDVNDIPVSNVTRFGTLKR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacttgtcgagtcgaacccgtggtgatgcccttccgacaagcgcgaggcatctt
cgcctgggtgtcgatctcggagcaacgcggatcaaggtcgttgtggtcgaaattgacgcc
tccggagaagtggctctgcgttttagtgctcagtatccgacagccgcggacgaaggaccc
tccgcagttgcggaacgacttgcccgctatgcgcttgacgccgtagctgaagttggacgt
gtggtcggtgccggcgtcggaattcctggcctctatcgtgcatccagcggtgagatcgag
ttcctgccgaacatgccgggcgcgtggcgaggcttccgcttgcgggagtacctgacaact
ctatggcgcgtacccgtggtcctcatcaacgacgcacgcgcgtttactctcgcggaagcg
cgtctcggcgctggcaaaggccaccaaaccgttgttggcgtgacggtaggtaccggcatt
gggggcggtctcgtcgttgacggccggttgctcatgggcagcgacggacgccgaggggag
gtcggtcatcagattgtggaggtcgatggtccgttatgtacctgcggtggcttcggctgt
gtcgaggctctcgcgggcagcctcgcactgatgcgtgccaccggtcttgcgtccttagac
gaaatctacgcggcggctgagcgcggcgagaaagaggcgcgagcggcagtggccagagcg
gcgaagtacctagccgccggaatcgcaaacgtcgtcacactgctgcggcccgaacgcgtg
gtcatcggtgggggcgccgcaagcgcgagcaggctgctgattgcatcgcttcgcgacatg
gttgcgcgacgagctgcactggttgacgccgagacgtacgaaattgttgccgccgagctt
ggcccggtcgccggcgcaattggcgcggccctctggtcggctgagatcgactcagggatg
tgtatggacgacgtcaatgacatacctgtcagcaacgtaacgcgtttcggtacgctcaaa
cggtaa

DBGET integrated database retrieval system