KEGG   Acidothermus cellulolyticus: Acel_0588Help
Entry
Acel_0588         CDS       T00426                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00010  Glycolysis / Gluconeogenesis
ace00020  Citrate cycle (TCA cycle)
ace00620  Pyruvate metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Module
ace_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0588
   00020 Citrate cycle (TCA cycle)
    Acel_0588
   00620 Pyruvate metabolism
    Acel_0588
Enzymes [BR:ace01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Acel_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: ABK52361
JGI: Acel0588
UniProt: A0LSF1
Position
complement(622313..623662)
Genome map
AA seq 449 aa AA seqDB search
MPEVFMPRLSDTMQEGTITQWTKKVGDQVEKGDVLAEIETDKAVMELEAYDSGVLEKILV
EPGKPVPIGTPIAIIGSGEGLQEPTGDSTAHAAPAEPKADQPAGAAPPTAVRETAAAAAS
ATTGRETAAAAAPATEPASETRPAAPPVSPLPVDGGRVKASPLARAIAREAGLDLRTVRG
SGPGGRVVRADVEAAVAAMRTAPAASPTAAPAAAASQPDVEEIPLNTIRKITARRLTESM
QQAPHFYLTRTLNAEPLIDVRARLNAALSSADPDTAKISLNDLIVKVAAAALRKHPEVNV
SYAGEKLLQHKHIHIGVAVAIPDGLIVPVIRDADTLGIREISQRTRDLATRARQGKLKPD
DIGGSTFTISNLGMFGVDQFTAVINPPEAAILAVGAVREVPVVRDGQLAVGKVMTITLSI
DHRALDGATAAGFLADLVTLLENPLAALA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaagtgttcatgccccggctctccgacacgatgcaggagggcacgatcacgcag
tggaccaagaaggtaggcgaccaggtcgagaagggcgatgtgctcgccgaaatcgagacc
gacaaggcggtgatggaactcgaggcgtacgactccggcgtgctcgagaaaatccttgtc
gagccgggcaaaccggtgccgatcggcacaccgatcgccattatcggcagcggggaaggc
cttcaggaaccaaccggcgattcgacggcgcacgctgcccccgctgaaccgaaggctgac
cagccagccggtgcagcgccgccgaccgccgttcgggagacggccgcagcggcagcgtcg
gcgaccaccggccgggagaccgcagcggcagcggcacccgccaccgagccggcaagcgag
acccgcccggccgcgccgccggtctcaccgcttccggtcgacggcggccgggtcaaagcc
tcgccgctggcccgggccatcgcccgggaggcaggcctcgatctgcggacggtccgcggt
tccgggccgggagggcgcgtcgtccgggcggacgtcgaagccgccgtggcggccatgcgg
acggcgccggccgctagtccgacggcagctccggcagccgcggcgtcgcaaccggatgtc
gaggaaattccgctcaacaccatccggaagatcactgctcggcgactcaccgagagcatg
cagcaagcaccgcacttctacttgacgcgcacgctgaacgccgagccgctgatcgatgtt
cgggcgcggctgaatgccgcgttgagcagcgccgatccggataccgcaaagatcagtttg
aatgatctgatcgtgaaggtggcggcggccgcgttacggaagcaccccgaagtgaacgtg
tcgtacgccggggagaagctgctccagcacaagcacattcacattggcgtggcggtcgcc
attcccgacggtctcatcgtcccggtcatccgcgacgccgacacgctgggcatccgggag
atctcgcagcgcacccgcgatctcgccacccgggcccggcagggcaagctcaagccggat
gacatcggcggctcgacgttcaccatcagcaatcttggcatgttcggcgtcgaccaattc
accgccgtgatcaacccgccggaggcggcgattctcgctgtcggcgcggtccgggaggta
cctgtggtgcgcgacggtcagctggcggtcggcaaggtgatgacaatcacgctgtccatc
gatcaccgagcgctggacggcgccaccgcggccggtttcctcgccgacctggtcaccctg
ctggagaacccgctcgcggcactcgcctga

DBGET integrated database retrieval system