KEGG   Acidothermus cellulolyticus: Acel_0614Help
Entry
Acel_0614         CDS       T00426                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ace  Acidothermus cellulolyticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acel_0614
Enzymes [BR:ace01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acel_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
653210..654898
Genome map
AA seq 562 aa AA seqDB search
MPRALRRVPGSRVMLRVGVVVAVLALVAALANLAVPRPARAAGGGYWHTSGREILDANNV
PVRIAGINWFGFETCNYVVHGLWSRDYRSMLDQIKSLGYNTIRLPYSDDILKPGTMPNSI
NFYQMNQDLQGLTSLQVMDKIVAYAGQIGLRIILDRHRPDCSGQSALWYTSSVSEATWIS
DLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIF
VEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNM
PGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTTDQTWLKTLVQYLRPTAQYGADSFQWTFW
SWNPDSGDTGGILKDDWQTVDTVKDGYLAPIKSSIFDPVGASASPSSQPSPSVSPSPSPS
PSASRTPTPTPTPTASPTPTLTPTATPTPTASPTPSPTAASGARCTASYQVNSDWGNGFT
VTVAVTNSGSVATKTWTVSWTFGGNQTITNSWNAAVTQNGQSVTARNMSYNNVIQPGQNT
TFGFQASYTGSNAAPTVACAAS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgcgcattgcggcgagtgcctggctcgcgggtgatgctgcgggtcggcgtcgtc
gtcgcggtgctggcattggttgccgcactcgccaacctagccgtgccgcggccggctcgc
gccgcgggcggcggctattggcacacgagcggccgggagatcctggacgcgaacaacgtg
ccggtacggatcgccggcatcaactggtttgggttcgaaacctgcaattacgtcgtgcac
ggtctctggtcacgcgactaccgcagcatgctcgaccagataaagtcgctcggctacaac
acaatccggctgccgtactctgacgacattctcaagccgggcaccatgccgaacagcatc
aatttttaccagatgaatcaggacctgcagggtctgacgtccttgcaggtcatggacaaa
atcgtcgcgtacgccggtcagatcggcctgcgcatcattcttgaccgccaccgaccggat
tgcagcgggcagtcggcgctgtggtacacgagcagcgtctcggaggctacgtggatttcc
gacctgcaagcgctggcgcagcgctacaagggaaacccgacggtcgtcggctttgacttg
cacaacgagccgcatgacccggcctgctggggctgcggcgatccgagcatcgactggcga
ttggccgccgagcgggccggaaacgccgtgctctcggtgaatccgaacctgctcattttc
gtcgaaggtgtgcagagctacaacggagactcctactggtggggcggcaacctgcaagga
gccggccagtacccggtcgtgctgaacgtgccgaaccgcctggtgtactcggcgcacgac
tacgcgacgagcgtctacccgcagacgtggttcagcgatccgaccttccccaacaacatg
cccggcatctggaacaagaactggggatacctcttcaatcagaacattgcaccggtatgg
ctgggcgaattcggtacgacactgcaatccacgaccgaccagacgtggctgaagacgctc
gtccagtacctacggccgaccgcgcaatacggtgcggacagcttccagtggaccttctgg
tcctggaaccccgattccggcgacacaggaggaattctcaaggatgactggcagacggtc
gacacagtaaaagacggctatctcgcgccgatcaagtcgtcgattttcgatcctgtcggc
gcgtctgcatcgcctagcagtcaaccgtccccgtcggtgtcgccgtctccgtcgccgagc
ccgtcggcgagtcggacgccgacgcctactccgacgccgacagccagcccgacgccaacg
ctgacccctactgctacgcccacgcccacggcaagcccgacgccgtcaccgacggcagcc
tccggagcccgctgcaccgcgagttaccaggtcaacagcgattggggcaatggcttcacg
gtaacggtggccgtgacaaattccggatccgtcgcgaccaagacatggacggtcagttgg
acattcggcggaaatcagacgattaccaattcgtggaatgcagcggtcacgcagaacggt
cagtcggtaacggctcggaatatgagttataacaacgtgattcagcctggtcagaacacc
acgttcggattccaggcgagctataccggaagcaacgcggcaccgacagtcgcctgcgca
gcaagttaa

DBGET integrated database retrieval system