KEGG   Acidothermus cellulolyticus: Acel_0624Help
Entry
Acel_0624         CDS       T00426                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ace  Acidothermus cellulolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acel_0624
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Acel_0624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
674964..675905
Genome map
AA seq 313 aa AA seqDB search
MGAPVAGRVIVVGSINRDIVARVGRLPSPGETVPGWDLEFLPGGKGANQAVAAARAGGRV
CFVGAVGADEAGVQNVTMLRAEGIDTREIRVVDGVPSGTAVIFVADTGENEIVIIGGANT
HVTGAAVREALQRINVTHQDVILTNFEIPDDAVDAAVEYGGAARCRLIVNPAPARPLTTA
LWNGRAILTPNRVESLVLTGLDDVHAAARSLTEQTRAPVVVTLGSDGALLADIDGDTHIA
ARQVPVVDTTGAGDVFVGVLAAEVAADVPLRSAVRRAVVAASLSVSRPGARAAPSLAELD
AAMTAGEPDTPRR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgccggtggcagggcgggtcatcgtcgttggttcgatcaaccgggatatcgtg
gcccgcgttggtcggttaccgagccctggcgagaccgttcccgggtgggatcttgaattt
cttccgggcggtaagggggcgaatcaagcggtcgctgcagcccgggctggtgggcgcgtg
tgtttcgtcggcgcggtcggtgcggatgaggccggcgtccagaacgtcacaatgctccgt
gccgagggaatcgacacccgtgagatacgggtcgtcgacggcgtcccgtcaggcaccgcg
gttatctttgtcgctgacaccggggagaacgaaatcgtcattatcggcggcgccaataca
cacgtcaccggagcggcggtgcgggaggcgctgcagcgaattaacgtgacgcaccaggac
gttatcctcaccaatttcgaaatccccgatgacgccgtggacgccgccgtcgagtacggc
ggcgccgcccgatgccggcttatcgtcaatccggcgccggcacggccgctcaccaccgcg
ctgtggaacggacgagcaattctcacgcccaaccgggtggagagcctggtcctcaccgga
ttagacgacgttcacgcggcggcgcggtcgcttacggagcagacgcgggcacccgtcgtc
gtcacgctcggcagcgatggtgcgttgctggccgacatcgacggcgacacgcatattgcg
gcgcggcaggtgcccgtggtcgatacgaccggcgcaggtgacgtattcgtcggcgtgctg
gctgccgaagtcgcggccgacgttcccttacggtcggcggtgcgacgtgccgttgtcgcc
gcgagcctttcggtgtcccgtcccggggcgcgcgcagcgccgagcctggcggaactcgac
gccgctatgaccgccggggagccagatactcctcgtcggtga

DBGET integrated database retrieval system