KEGG   Acidothermus cellulolyticus: Acel_0631Help
Entry
Acel_0631         CDS       T00426                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00260  Glycine, serine and threonine metabolism
ace00750  Vitamin B6 metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01230  Biosynthesis of amino acids
Module
ace_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_0631
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acel_0631
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acel_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABK52404
JGI: Acel0631
UniProt: A0LSJ4
Position
683661..684758
Genome map
AA seq 365 aa AA seqDB search
MTTTSTAAAARPRWRGLIEEYRRWLPVSDDTPVITLQEGGTPLLPAPVLSEKTGCEVYLK
VEGANPTGSFKDRGMTVAISKAVQAGSRAVICASTGNTSASAAAYAARAGLLCAVLVPQG
KIALGKLAQALVHGAKLLQIDGNFDDCLALAAKLAQDYPVTLVNSINPDRIEGQKTAAFE
IVDALGDAPDVHCLPVGNAGNITAYWKGYVEYADPSRGGPARRRPRMFGFQAAGAAPIVL
GRVVEKPSTIATAIRIGNPASWTKALEARDASGGAILSVTDRQILAAYRLLATREAVFVE
PASAASVAGLLAAREQGLLDRGLRVVCTVTGNGLKDPDWAIAGAPAPVTVPPDPQAAART
LGLHA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccagcaccgccgcggccgcccgaccacgatggcgcgggctcatcgaggag
taccgcagatggcttccggtcagtgacgacaccccggtcatcaccctccaagaaggcggc
actccgctgctccccgccccggtgctctctgagaagaccggatgcgaggtctacctcaag
gtcgaaggggcgaatcccaccggctcgttcaaggaccgcggcatgaccgtggcgatcagc
aaggcggtgcaggccggttcccgggcggtgatctgcgcatcgaccggaaacaccagcgcg
agtgcggcggcgtacgccgcgcgtgccgggctgctctgcgccgtgcttgtcccgcaagga
aaaatcgcgctcggcaaattggcgcaggcattggtgcacggcgcgaaattgctgcagatc
gacgggaatttcgacgattgcctcgcgctggcggccaagcttgcgcaggattacccggtc
acgttggtgaattccatcaatcccgaccgtatcgaagggcagaagaccgcggcgttcgaa
atcgtggacgcgctcggcgatgcgcccgacgtccactgccttccggtcgggaacgccggg
aacatcaccgcctactggaaggggtacgtcgagtacgccgatcccagccgcggcggtccg
gcccggcgtcgtccccggatgttcggcttccaggccgccggcgctgcaccgatcgtcctc
ggccgggtcgtcgagaaaccgtcgacgatcgccaccgcgattcgcatcggcaacccggcg
agctggacgaaggcgctcgaggcacgggacgcctcgggtggggcgattctgtcggtgacc
gaccgccagattctggccgcataccgcctgctcgccacccgggaggccgttttcgtcgaa
ccggcaagcgccgccagcgtcgccgggctgcttgcggcccgcgagcagggtctccttgac
cgcggtctgcgggtcgtctgcacggtcaccggaaacgggctcaaggatcccgattgggcg
atcgccggcgcgcctgcgccggtcaccgtcccgccggatccgcaggccgcggcccggacg
ctcgggctgcacgcctga

DBGET integrated database retrieval system