KEGG   Acidothermus cellulolyticus: Acel_0631Help
Entry
Acel_0631         CDS       T00426                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acel_0631
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_0631
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acel_0631
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acel_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
683661..684758
Genome map
AA seq 365 aa AA seqDB search
MTTTSTAAAARPRWRGLIEEYRRWLPVSDDTPVITLQEGGTPLLPAPVLSEKTGCEVYLK
VEGANPTGSFKDRGMTVAISKAVQAGSRAVICASTGNTSASAAAYAARAGLLCAVLVPQG
KIALGKLAQALVHGAKLLQIDGNFDDCLALAAKLAQDYPVTLVNSINPDRIEGQKTAAFE
IVDALGDAPDVHCLPVGNAGNITAYWKGYVEYADPSRGGPARRRPRMFGFQAAGAAPIVL
GRVVEKPSTIATAIRIGNPASWTKALEARDASGGAILSVTDRQILAAYRLLATREAVFVE
PASAASVAGLLAAREQGLLDRGLRVVCTVTGNGLKDPDWAIAGAPAPVTVPPDPQAAART
LGLHA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgaccagcaccgccgcggccgcccgaccacgatggcgcgggctcatcgaggag
taccgcagatggcttccggtcagtgacgacaccccggtcatcaccctccaagaaggcggc
actccgctgctccccgccccggtgctctctgagaagaccggatgcgaggtctacctcaag
gtcgaaggggcgaatcccaccggctcgttcaaggaccgcggcatgaccgtggcgatcagc
aaggcggtgcaggccggttcccgggcggtgatctgcgcatcgaccggaaacaccagcgcg
agtgcggcggcgtacgccgcgcgtgccgggctgctctgcgccgtgcttgtcccgcaagga
aaaatcgcgctcggcaaattggcgcaggcattggtgcacggcgcgaaattgctgcagatc
gacgggaatttcgacgattgcctcgcgctggcggccaagcttgcgcaggattacccggtc
acgttggtgaattccatcaatcccgaccgtatcgaagggcagaagaccgcggcgttcgaa
atcgtggacgcgctcggcgatgcgcccgacgtccactgccttccggtcgggaacgccggg
aacatcaccgcctactggaaggggtacgtcgagtacgccgatcccagccgcggcggtccg
gcccggcgtcgtccccggatgttcggcttccaggccgccggcgctgcaccgatcgtcctc
ggccgggtcgtcgagaaaccgtcgacgatcgccaccgcgattcgcatcggcaacccggcg
agctggacgaaggcgctcgaggcacgggacgcctcgggtggggcgattctgtcggtgacc
gaccgccagattctggccgcataccgcctgctcgccacccgggaggccgttttcgtcgaa
ccggcaagcgccgccagcgtcgccgggctgcttgcggcccgcgagcagggtctccttgac
cgcggtctgcgggtcgtctgcacggtcaccggaaacgggctcaaggatcccgattgggcg
atcgccggcgcgcctgcgccggtcaccgtcccgccggatccgcaggccgcggcccggacg
ctcgggctgcacgcctga

DBGET integrated database retrieval system