KEGG   Acidothermus cellulolyticus: Acel_0702Help
Entry
Acel_0702         CDS       T00426                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_0702
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0702
   00020 Citrate cycle (TCA cycle)
    Acel_0702
   00620 Pyruvate metabolism
    Acel_0702
   00640 Propanoate metabolism
    Acel_0702
   00650 Butanoate metabolism
    Acel_0702
  Energy metabolism
   00680 Methane metabolism
    Acel_0702
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acel_0702
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acel_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
764718..765701
Genome map
AA seq 327 aa AA seqDB search
MSADNGRSLSLTTRTAGGRLVPPARRAEQANPHRRNALTSGHRACQGCGVALAARTVVDA
AYRASGGKLVVVTATGCLEVFSTPYPESAWRVPWLHSLFANAASVASGVAAALYAQGRED
VRVLAQGGDGATVDIGLACLSGMFERGDDVLYVCYDNEAYMNTGIQRSGATPPYARTATT
EAVGDEPGNPPGTGKDLPRIALAHSIPYVATATIGDIHDLEAKVVNAMGVRGARYLHVLT
PCPLGWGSGPAETIALARLAQRSGLFPVFEARDGEITSVLPIRRPVPVEEYLRPQRRFAH
LFADPDRRLLTRLQEFADSTKARYGLM
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgacaacggacggtccctttcgctgacaacccgcacggctggcggcagactg
gttccccccgcgcggcgtgcggaacaggctaatccacaccgacgcaacgcactgacctcg
ggtcaccgcgcctgccagggatgcggagttgctctcgctgctcgtaccgtcgttgatgct
gcgtaccgcgcctccgggggaaaactcgttgtcgtgacagcaaccggatgtcttgaggtg
ttctcaacaccctatccggagagcgcgtggcgggttccttggttgcactcgttgttcgct
aatgcggcatcggtggcaagcggtgtggcggccgcgctgtacgcccagggacgggaggac
gttcgagtccttgcgcagggcggggacggagcgaccgtcgacatcggcctcgcctgcctc
tccggcatgttcgaacgaggcgatgacgtcctgtatgtgtgttacgacaacgaggcgtat
atgaataccggcattcagcgctcgggtgcgacaccgccatatgcgcggaccgcaacaacg
gaagcggtcggagacgagccgggaaatccgcctgggacgggaaaggacttgccgcgtatc
gcgctcgcgcacagcattccctacgtagcgacggcgaccataggcgatattcacgacctt
gaggccaaagtggtgaacgcgatgggtgtgcgtggagcccgatacctgcacgtcctgaca
ccctgtccccttggttgggggagcggacctgctgagacgatcgcattggcccgccttgcc
cagcgttccggtttgttcccggttttcgaagcacgggacggggaaatcacctcggtgctt
ccgattcggcggccggttccggtcgaggagtacctccggccgcaacgccgattcgcccat
ctgttcgccgatccggaccgtcgcctgctcaccaggttgcaggaattcgccgacagcacg
aaggcgcggtacggcttgatgtga

DBGET integrated database retrieval system