KEGG   Acidothermus cellulolyticus: Acel_0935Help
Entry
Acel_0935         CDS       T00426                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ace  Acidothermus cellulolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_0935
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_0935
  Amino acid metabolism
   00310 Lysine degradation
    Acel_0935
Enzymes [BR:ace01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acel_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1030670..1032100)
Genome map
AA seq 476 aa AA seqDB search
MPVVVTMPRLGESVTEGTVTRWLKKAGDRVVADEPLVEVSTDKVDTEIPAPASGVLREIR
VREDETVQVGAELAVIDDADGAAAPPPEAATAAAPAPPAASTPDAAAAAPGAVTAPAPVP
SAAPPGAMTGPAPAAAEASAPTPAAVPAEAPPPAAPPEIPSQPGAAAAAPPEPTEAPSAE
TPYVTPLVRRLAAEHGVDLTRLTGTGVGGRIRKQDVLAAAEARYAKQPVQSATAPQLRGR
TEPLSRLRAVIAARAVESLRTSAQLTAVVEADVTKIARLRDAVKKDFEAREGVRLSFFPF
FALAAIEALKQHPKLNASIDTDAGTVTYHDIENLGIAVDTERGLLFPVIHNAGDLSLAGL
AKRVADLAERARAGRVTPDELTGGTFTLTNAGRHGVLFDTPILVPPQVGVLGIGAVVKRP
VVVDDPELGETIAIRSIVHLALTYDQRLVDGGEAAAFLATVRARLEEGRFEPDVGH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcgtcgtcaccatgccccgccttggcgagagcgtcacggaaggcactgtcacc
cgctggctgaagaaggccggtgaccgcgtcgtcgccgacgaacccctcgtcgaagtctcg
accgacaaagtggacaccgaaattcccgcgccggcatccggtgtgctccgcgaaatccgg
gtccgcgaagacgaaaccgtgcaggtcggcgccgaacttgccgtcatcgatgacgcggac
ggcgcggccgctcccccgcccgaggccgctacagccgctgctcccgcgccgccggcagcc
tccacgccggacgcagccgccgctgcaccgggcgccgtgacagctccggctcccgtcccg
tctgccgctcccccaggcgctatgaccgggccggctccggctgcggcggaagcctcggcc
ccgaccccggccgcggtcccggccgaggcaccgcccccggcggcacccccggaaatcccc
agccagcccggggcggccgccgctgcaccacccgagccgaccgaagcgcccagcgccgag
accccttatgtcacaccgttggttcggcgcctggcggccgaacacggtgttgacttgacc
cgcctgaccgggaccggggtcggcggtcgaatccgcaagcaggatgtactggcggccgca
gaggcgcggtatgcgaagcaacccgtccaatccgcgacggcgccgcagctgcgcggccga
accgaaccgctgtcgcggttgcgcgccgtcattgccgcccgcgcggtcgaatcgttgcgg
acatccgctcaactcaccgcggtcgtcgaagccgatgtcacgaaaattgccaggcttcgc
gacgcggtgaagaaggatttcgaagcacgggaaggcgtccggttatccttcttcccgttt
ttcgcccttgcggcaattgaagcgctcaagcagcatccgaaactcaacgcaagcattgac
acggacgcaggcaccgtcacctaccacgacatcgagaatctcggcatcgcggtggacacc
gaacgcggcctgctgttcccggtcatccacaacgccggcgacctgagccttgccgggttg
gcgaaacgagtcgcggatctcgccgaacgggcccgcgccggacgggtcacgccggacgag
ctcaccggcggcacgttcacactgacgaatgccggccggcatggggttctgttcgacaca
ccgattctcgtgccgccgcaggtcggcgtgctgggcatcggcgcggtcgtcaaacgcccg
gttgtcgtcgacgatcccgaacttggggagaccatcgcgattcggtccatcgtccacctc
gccctcacgtacgatcagcggttggtcgacggcggggaggctgcagcttttctcgccacc
gtccgggcacggctcgaagagggccgattcgagccggacgtcggacactga

DBGET integrated database retrieval system