KEGG   Acidothermus cellulolyticus: Acel_0935Help
Entry
Acel_0935         CDS       T00426                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ace  Acidothermus cellulolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_0935
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_0935
  Amino acid metabolism
   00310 Lysine degradation
    Acel_0935
Enzymes [BR:ace01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acel_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1030670..1032100)
Genome map
AA seq 476 aa AA seqDB search
MPVVVTMPRLGESVTEGTVTRWLKKAGDRVVADEPLVEVSTDKVDTEIPAPASGVLREIR
VREDETVQVGAELAVIDDADGAAAPPPEAATAAAPAPPAASTPDAAAAAPGAVTAPAPVP
SAAPPGAMTGPAPAAAEASAPTPAAVPAEAPPPAAPPEIPSQPGAAAAAPPEPTEAPSAE
TPYVTPLVRRLAAEHGVDLTRLTGTGVGGRIRKQDVLAAAEARYAKQPVQSATAPQLRGR
TEPLSRLRAVIAARAVESLRTSAQLTAVVEADVTKIARLRDAVKKDFEAREGVRLSFFPF
FALAAIEALKQHPKLNASIDTDAGTVTYHDIENLGIAVDTERGLLFPVIHNAGDLSLAGL
AKRVADLAERARAGRVTPDELTGGTFTLTNAGRHGVLFDTPILVPPQVGVLGIGAVVKRP
VVVDDPELGETIAIRSIVHLALTYDQRLVDGGEAAAFLATVRARLEEGRFEPDVGH
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcgtcgtcaccatgccccgccttggcgagagcgtcacggaaggcactgtcacc
cgctggctgaagaaggccggtgaccgcgtcgtcgccgacgaacccctcgtcgaagtctcg
accgacaaagtggacaccgaaattcccgcgccggcatccggtgtgctccgcgaaatccgg
gtccgcgaagacgaaaccgtgcaggtcggcgccgaacttgccgtcatcgatgacgcggac
ggcgcggccgctcccccgcccgaggccgctacagccgctgctcccgcgccgccggcagcc
tccacgccggacgcagccgccgctgcaccgggcgccgtgacagctccggctcccgtcccg
tctgccgctcccccaggcgctatgaccgggccggctccggctgcggcggaagcctcggcc
ccgaccccggccgcggtcccggccgaggcaccgcccccggcggcacccccggaaatcccc
agccagcccggggcggccgccgctgcaccacccgagccgaccgaagcgcccagcgccgag
accccttatgtcacaccgttggttcggcgcctggcggccgaacacggtgttgacttgacc
cgcctgaccgggaccggggtcggcggtcgaatccgcaagcaggatgtactggcggccgca
gaggcgcggtatgcgaagcaacccgtccaatccgcgacggcgccgcagctgcgcggccga
accgaaccgctgtcgcggttgcgcgccgtcattgccgcccgcgcggtcgaatcgttgcgg
acatccgctcaactcaccgcggtcgtcgaagccgatgtcacgaaaattgccaggcttcgc
gacgcggtgaagaaggatttcgaagcacgggaaggcgtccggttatccttcttcccgttt
ttcgcccttgcggcaattgaagcgctcaagcagcatccgaaactcaacgcaagcattgac
acggacgcaggcaccgtcacctaccacgacatcgagaatctcggcatcgcggtggacacc
gaacgcggcctgctgttcccggtcatccacaacgccggcgacctgagccttgccgggttg
gcgaaacgagtcgcggatctcgccgaacgggcccgcgccggacgggtcacgccggacgag
ctcaccggcggcacgttcacactgacgaatgccggccggcatggggttctgttcgacaca
ccgattctcgtgccgccgcaggtcggcgtgctgggcatcggcgcggtcgtcaaacgcccg
gttgtcgtcgacgatcccgaacttggggagaccatcgcgattcggtccatcgtccacctc
gccctcacgtacgatcagcggttggtcgacggcggggaggctgcagcttttctcgccacc
gtccgggcacggctcgaagagggccgattcgagccggacgtcggacactga

DBGET integrated database retrieval system