KEGG   Acidothermus cellulolyticus: Acel_0983Help
Entry
Acel_0983         CDS       T00426                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_0983
   01230 Biosynthesis of amino acids
    Acel_0983
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_0983
   00030 Pentose phosphate pathway
    Acel_0983
   00051 Fructose and mannose metabolism
    Acel_0983
   00052 Galactose metabolism
    Acel_0983
  Energy metabolism
   00680 Methane metabolism
    Acel_0983
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acel_0983
Protein phosphatases and associated proteins [BR:ace01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Acel_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1082058..1083083
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAAVRKGVTEFGYEFVGFRDGWRGPIECDTMPLGIPEVRGI
LPRGGTILGTSRTNPAKIDRGYDLVVENLDKLGIDALIAIGGEDTLGVATKLHDRGVHVV
GVPKTIDNDLSATDYTFGFDTAVNIAMEAIDRLHTTAESHHRALIVEVMGRHAGWIALHA
GLAGGANVILIPEIPFDIEKVCDYIEKRFQSRYAPIVVVAEGATPVEGTMALASGELDAF
GHVRLGGIGQRVADEIEKRTGKEARTTVLGHIQRGGTPTAFDRVLATRFGLHAIDAVRDG
AWGTMVALRGTDIVRVPLAEATGALKTVPPERYAEAQVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgtcggagtgctgacgggtggcggggactgcccaggtctcaacgccgttatccgg
gccgccgtccggaaaggcgtcaccgaattcggatatgaattcgtcggatttcgggacggc
tggcgtggaccgatcgagtgcgacaccatgccgctcggaattcccgaagtgcggggaatt
ctgccgcggggcggcacaatccttggcacctcgcgcacgaatccggcgaaaatcgaccgc
ggctacgacctggtcgtggagaatctcgacaagctcggtatcgacgcgctcatcgccatc
ggcggcgaggacaccctcggcgttgcgacgaaattgcatgaccgcggcgtgcacgtggtc
ggtgtcccgaagaccatcgacaatgacctgtcggcgacggattacacgttcgggttcgac
acggcggtgaacatcgccatggaggcgattgaccggttgcacaccaccgccgaatcgcac
caccgggcgctcatcgtcgaggtgatgggccgccacgcgggatggatcgccctgcacgcc
ggtctggccggcggcgccaacgtcatcctcatcccggaaatcccctttgacatcgagaag
gtctgcgactacatcgagaagaggttccagagccgctacgcgccgatcgtcgtcgtcgcc
gaaggagccaccccggtggaggggacgatggcgctggcgagcggcgaacttgacgccttc
gggcacgtccggctggggggcatcggtcaacgggtggcggacgaaatcgagaagcggacc
ggcaaggaagcgcggacgactgtcctcggccacattcagcggggtgggacgccgaccgcc
ttcgaccgggtgctcgcgacccggttcgggctgcacgcgattgacgcggtccgcgacggt
gcgtgggggacgatggtcgccctgcgtggcacggacatcgtccgggtgcccctggcggag
gcgaccggcgcgctcaagacggtgccgccggaacggtacgccgaggcgcaagtgtttttc
ggctga

DBGET integrated database retrieval system