KEGG   Acidothermus cellulolyticus: Acel_1005Help
Entry
Acel_1005         CDS       T00426                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ace  Acidothermus cellulolyticus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Acel_1005
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Acel_1005
Enzymes [BR:ace01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Acel_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1109396..1110964
Genome map
AA seq 522 aa AA seqDB search
MPDTLRPARVDPVPLATLAALARAELRGPAAGSTAGILICGVTHDSRRVQPGDLFAALPG
AHTHGARYVADAVTAGAVAVLTDPAGASLINREVPLLICADPRKTLGPVAAAIYGHPARA
LVTLGVTGTNGKTTTVFFLDAGLRAAGHRTGLLGTVMTRLGERTVPSARTTPEAPDIQAL
LARMRDDGITAAAMEVSSHALALHRVDGTGFACVGFTNLSHDHLDFHGDMENYFAAKARL
FRPDFAPKAVIVVDDEYGRRLADTAPIAVRTVSGRPEHLPPDRRPDWRVVAVRAAAAVSP
TRPAGQVATVAGPIGEVELSLQLPGRFNLTNALLALAILVEVGIPVEAARAGIGDLAGVP
GRLELVDAGQPFAVLVDYAHTPEAVATVAREVRPDRGRLIIVIGCGGDRDPSKRPAMGAA
AAELADLAIFTSDNPRSEDPEEIVAAMLTGVPAVTADRRAEIRVELDRHEAIKDAIQAAR
PGDVVLIAGKGHEQGQEIGGVVHPFDDRLAARDALRSCGWAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgacaccctgcggccggcacgggtggatccggtgccgctcgccactctcgccgcg
ctggcccgcgctgaactccgtggcccggcggccggctcaaccgccgggatactgatctgc
ggcgtcactcatgattcgcgccgcgtgcagcccggcgacctgttcgcggcgcttcccggc
gctcacacccacggcgcccggtacgtcgccgacgcggtgactgccggcgcggtcgcggtt
ctcacggacccggccggcgcttccctgatcaaccgcgaggttccgttgctcatctgcgcc
gacccgcggaaaacgctgggacccgtcgcggccgccatttatggacatcccgcccgggcg
ctggtgaccctcggtgtcaccggcaccaacggcaagacgaccactgtcttcttcctggac
gccggattgcgggccgccggccatcggaccggcctgctgggaacggtgatgacccggctt
ggtgagaggacggtgccgagtgcacgcaccacgcccgaggcgcccgacatccaggcactt
ctcgcgcgcatgcgcgacgacgggatcactgctgcggcgatggaagtatccagtcacgcc
ctggccttgcaccgcgtggacggaaccggtttcgcctgcgtggggttcacgaatctgtcc
cacgatcacctggactttcacggagacatggaaaactactttgcggccaaggcccggctg
ttccgcccggactttgcgccgaaggcggtgatcgtcgtggacgacgagtacggccggcgt
ctcgccgacaccgcaccgatcgccgtccggaccgtctccggccggccggaacacctcccg
cccgaccgccggccggactggcgggtcgtggctgtccgcgccgccgccgcggtgtcgccg
acccggcccgccgggcaggtggcgacagttgccggaccgatcggcgaggtggagctctcg
ctccagctccctggccggttcaatctgaccaatgcgctgctcgccctggccatcctggtc
gaggtcggcatcccggttgaggccgcgcgagcgggcatcggtgacctcgccggcgtaccc
gggcggcttgaacttgtcgacgccgggcagccgttcgccgttctcgtcgactacgcgcac
accccggaggcggtcgcgacggtggcccgggaagtccgtcccgaccgcgggcgcctcatc
attgtgatcggttgcggtggtgaccgggatccgagcaagcgtcctgccatgggcgcggca
gccgccgagttggcggacctggccatcttcaccagcgacaacccccgcagtgaagatcca
gaggagatcgtggccgcgatgctcaccggcgtgccggcggtgaccgccgaccggcgcgcg
gagatccgtgtggaactcgaccggcacgaggcgatcaaggacgcgatccaggcggcccgg
ccgggtgacgtcgtcctcatcgccggcaagggtcatgaacaggggcaggagatcggcggg
gtcgtgcatccgttcgacgatcgcttggccgcccgtgacgcacttcgttcctgcgggtgg
gcggcgtga

DBGET integrated database retrieval system