KEGG   Acidothermus cellulolyticus: Acel_1058Help
Entry
Acel_1058         CDS       T00426                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00340  Histidine metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Acel_1058
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Acel_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABK52831
JGI: Acel1058
UniProt: A0LTS1
Position
1167840..1169186
Genome map
AA seq 448 aa AA seqDB search
MTDAVTTEDLRALRRLDLRGRTLSLRDLRDALPRPRLDVDAAVEVVRPICAEVRDGGAAA
AREITKRLDGVEAAALRVDRAQLDAAVAALDADLRAALLAAADRVRRVHEAQRPADVTIA
VADGLRVVERWRPVRRVGLYVPGGRVAYPSSVVMNVVPAQVAGVESIVVVSPPQRATGGL
PHPAVLAACALLGVTEVYAVGGAQAVALLAYGSGAEQGELVEPVDVITGPGNVYVAAAKR
LVRGLVGIDAEAGPTEIAILADATADPHLIAVDLIAQAEHDELATCLLVTTDPALADQVD
EWLRRLVPVTRHVDRVRDALRGQGTVVLVDSVDAGLAVVDAFAAEHLEIHTTDAEAVAAR
VRNAGAIFVGPFAPVSLGDYLAGSNHVLPTGGTARHTGGLSVFSFLRMVHEVSCTADALA
AAAPAIDALGAAEELAAHVAAVRARVGP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgccgtcactaccgaagacctccgtgcgttgcgccggttggacctccggggc
cggacgctgtcgctgcgtgacctgcgcgacgcgttgccccggcctcggctcgacgtcgat
gccgccgtcgaagtcgtccgcccgatctgcgcggaggtgcgtgacggcggcgccgccgca
gcccgggagatcaccaagaggctggacggcgtcgaggcggctgcgctgcgcgtcgaccga
gcccagctggacgccgcggtggctgcgctggacgccgacctgcgcgcggccctgctcgca
gcggccgaccgggtccgccgcgtgcacgaggcacagcggccggccgatgtgaccattgcg
gtcgccgacggactgcgggtggtcgagcggtggcgtccggtccggcgggtcggcctgtac
gtgcccggcgggcgggtcgcgtacccgagcagcgtcgtcatgaacgtcgtaccggcacag
gtcgccggtgtcgaatcgatcgtcgtcgtctccccgccgcagcgggccaccggcggtctg
ccgcatccggcggtgctcgcggcgtgcgccctgcttggggtcaccgaggtgtacgccgtc
ggcggggcgcaagccgtcgcgctgcttgcctatgggagtggcgccgagcagggcgagctt
gtcgaaccggtcgacgtcatcacgggcccgggcaacgtgtacgtcgccgcagcaaagcgg
ctggtccgcggactggtgggcatcgacgccgaagcaggcccaaccgagatcgccatcctt
gccgatgcgaccgccgacccgcacctcattgccgtggacctcatcgcccaggcggaacac
gacgagctggcgacctgcctgctcgtcacgaccgaccctgcgctcgccgaccaggttgac
gaatggctgcgccggttggtgcccgtgacgcggcacgtggaccgggtccgcgacgcgctg
cgcggccaaggcaccgtggtgctggtcgattcggtggacgccgggctcgccgtcgtcgac
gcctttgccgctgagcacctggaaattcacacgacggacgccgaggcggttgccgcccgg
gtccgcaacgcgggcgcgattttcgtcggtccgttcgcaccggtgagtctgggtgactat
ctggccgggtccaaccatgtgctcccaaccggcggcacagcgcggcacaccggcggcctg
tcggtcttctcgttcctgcggatggtgcacgaggtttcctgcacggcggatgcgcttgcc
gcggccgcgccggcgatcgatgcgctgggtgcggccgaggagctggccgcgcacgtggct
gccgtccgtgcccgggtggggccatga

DBGET integrated database retrieval system