KEGG   Acidothermus cellulolyticus: Acel_1073Help
Entry
Acel_1073         CDS       T00426                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ace  Acidothermus cellulolyticus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acel_1073
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acel_1073
Enzymes [BR:ace01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Acel_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1183326..1184189
Genome map
AA seq 287 aa AA seqDB search
MFRPQRGSGTASVGGSVPVSLLDDIMAGVRADVAARQRLVPLDQLKARAAGRPRPLDGVA
ALKRDAVTVIAEVKRSSPSRGDLAPIPDPAALAREYAAGGAAAISVLTEPRRFHGSLADL
EAVRQAVEIPVLRKDFIYCSYQLWEALAYGADLVLLIVAVLDQSALVSLIERAESLGLTP
LVEVHTAEEVSRAVDAGARIIGVNARDLRTFEVDRDLFGRLAPRIPNGIVKVAESGVRGP
RDLLAYAAAGADAVLVGEGLVTDRNPRQAVAELVTAGAHPALRHEAI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgcccgcagcgcgggagcggaacagcgtcggtcggagggtccgtgccggtgagc
ctgctcgacgacatcatggccggtgtccgggcggacgtcgctgcgcggcaacgtctcgtg
ccgttggaccaactcaaggctcgtgccgccggccggccccgtccgctggacggcgtcgcc
gccctcaagcgggacgcggtcacggtcatcgccgaggtgaaacggtcgagtccgtctcgc
ggcgatctcgcgccgatccccgatccagctgcgctcgcccgcgagtacgccgcaggcggc
gccgcggcaatcagcgtgctcaccgagccgcgccgattccacggttcgctggctgatctc
gaggccgtccggcaggccgttgagattcccgtgctccgcaaggatttcatctactgctcg
taccagctctgggaagcgctggcctacggcgcggatctcgtgttgctgatcgtcgcagtg
ctcgatcagagcgcgctggtgtccctgattgaacgggcggaatctctcggcctcaccccg
ctcgtcgaagtgcacacggccgaagaagtcagtcgtgccgtggacgccggtgcgcggatc
atcggcgtgaatgcccgcgacctgcggaccttcgaggtcgaccgcgaccttttcggacgg
ctggcgccgcggattcccaacggaatcgtcaaggtcgccgagtcgggggtgcgcggaccg
cgagatctcctcgcgtatgcggcagccggggctgacgccgtcctggtcggggaaggactg
gtgaccgaccggaacccccggcaagccgtcgccgaactcgtcacggccggcgcgcacccg
gctctccggcacgaggccatctag

DBGET integrated database retrieval system