KEGG   Acidothermus cellulolyticus: Acel_1074Help
Entry
Acel_1074         CDS       T00426                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acel_1074
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_1074
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acel_1074
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acel_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1184212..1185489
Genome map
AA seq 425 aa AA seqDB search
MSGVRPALPDAAGHFGPFGGRFVPEALVAALDELAAAHAVAMADPDFQRELRQLLTSYAG
RPTPITEARRFSEHAGGARILLKREDLTHTGSHKINNVLGQALLTVRMGKKRVIAETGAG
QHGVATATAAALFGLDCTIYMGEEDTRRQALNVARMRLLGADVVPVDAGTRTLKDAINEA
FRDWVTTVEYTHYVFGTVAGPHPFPAVVRDFQRIIGDETRTQVLDALGRLPDAVVACVGG
GSNAIGIFTAFLADPQVRLYGFEAGGEGIETGRHAATLSAGSRGVLHGARTYVLQDADGQ
TRPSHSISAGLDYPGVGPEHAWLRETGRVCYQPVTDAEAMDAFRLLARTEGILAALESAH
ALAGALRVGRELGPGSVVVVSLSGRGDKDVQTAARWFGLDASDRSSRSAAYRRPGSGVDV
PGRPM
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgtccgaccagcgttgccggatgccgccgggcatttcggcccgttcggcggg
cgcttcgtaccggaggcgctcgtcgcggcactggacgagctcgccgctgcacacgcggtg
gcgatggccgatccggatttccagcgcgaactacggcagctgctcacgtcctacgccggc
cggccgacaccgatcaccgaggcgcggcggttctccgagcacgccggcggagcccgcatt
ctgctgaaacgcgaggacctgacgcacaccggctcccacaagatcaataacgtgctgggg
caggcactgctcactgtccggatgggcaagaagcgggtcatcgccgagaccggggcaggc
cagcatggcgtggcgaccgctacggctgcggcgctcttcggcttggactgcacgatctac
atgggcgaggaggacacgcgccggcaggccctgaacgtggcccggatgcggttgctcggc
gcggacgtcgtcccggtcgacgccggtacccgcacgttgaaagatgcgataaacgaggca
ttccgcgactgggtgacgaccgtcgaatacacccactacgtcttcggcacggtggccggc
ccgcatccttttcccgcggtggtccgcgattttcagcggatcatcggcgacgagacgcgg
acccaggtgctcgacgctctcggacggttgccggacgcggtggtcgcctgtgtcggcggc
gggtccaatgccattgggattttcaccgccttccttgcggatccgcaggtccggctgtac
ggatttgaagccggcggggaggggatcgagacgggtcggcatgcggcgacgttgagcgcc
gggagccggggcgtcctgcacggcgcccgcacctacgtgctgcaggacgccgacggccag
acccgcccgtcgcattccatttccgcggggttggactacccgggcgtcgggccggaacac
gcgtggctgcgggaaaccggacgggtctgctaccagccggtcaccgacgccgaagcgatg
gacgcgttccggcttctggcccgcacggagggcattctcgcggcgttggagagcgcgcac
gccctggccggcgcgttacgggtcgggcgggagcttggccccgggagtgtcgtggtcgtc
agcttgtcggggcgcggcgacaaagacgtgcagaccgcggcccggtggttcggccttgat
gcgtcggacaggtccagcaggtcggccgcgtaccgccggccgggctccggcgtggacgtc
cccggcaggccgatgtga

DBGET integrated database retrieval system