KEGG   Acidothermus cellulolyticus: Acel_1075Help
Entry
Acel_1075         CDS       T00426                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acel_1075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acel_1075
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acel_1075
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acel_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1185486..1186289
Genome map
AA seq 267 aa AA seqDB search
MTAVGEALRRCRAEGRAALVGYLPACFPDVERGIANLQALLDGGVDILEIGLPYSDPVLD
GPVIARAADVALRAGSTTAAVLRTLEAVAASGAAAVIMTYWNPVEQYGVDRFAAAVAAAG
GSGLVTPDLLPDEAEAWLAASDAHGLDRIFLVAPSSTDERIALTVRFCRGFVYAASVMGV
TGVRERASVQAPELVARVRRYTSLPVGVGLGVGTAEQAAEVAQYADAVIVGSAFVRCVFD
AGDDAPAALRKLAADLAAGVRRMPATG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgtcggtgaggctttgcgccggtgccgcgcggagggccgtgccgcgctggtg
ggttacctgccggcgtgtttcccggacgtcgagcgcggcatcgcgaacctccaggccctc
ctcgacggaggcgtcgacatcctggaaatcggcttgccgtacagcgatcccgtcctcgat
gggccggttatcgcccgggccgccgacgtggcgctccgcgccggttccacgacggctgcc
gtcctgcgcaccctcgaagcggtcgcggcttccggagccgcagccgtaatcatgacgtat
tggaatcccgtcgagcagtacggcgtcgaccggttcgccgcagcagtggccgccgcggga
ggaagcggcctcgtcacaccggacttgctgcccgatgaagcggaagcctggctggcagcc
agtgatgcacatggcctggatcggatttttctcgtcgccccaagctcgaccgacgaacgg
atcgcgttgaccgtccggttctgccgtgggttcgtctatgcggcgtccgtgatgggtgtc
accggcgtccgggagcgggcaagcgtccaagccccggagctggtcgcccgggtccgccgt
tatacgtcactgccggttggtgtcggactcggcgtgggcacggccgagcaggcggcggag
gtcgcccagtacgctgacgcggtcatcgtcggttccgcgttcgtgcggtgtgtcttcgac
gccggggacgacgctccggccgcgctccgcaagctcgcggccgaccttgccgccggggtg
cgcaggatgccggcaaccgggtag

DBGET integrated database retrieval system