KEGG   Acidothermus cellulolyticus: Acel_1115Help
Entry
Acel_1115         CDS       T00426                                 

Definition
(RefSeq) bifunctional phosphoglycerate kinase/triosephosphate isomerase (EC:2.7.2.3 5.3.1.1)
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_1115
   01230 Biosynthesis of amino acids
    Acel_1115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_1115
   00051 Fructose and mannose metabolism
    Acel_1115
   00562 Inositol phosphate metabolism
    Acel_1115
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Acel_1115
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acel_1115
Exosome [BR:ace04147]
 Exosomal proteins
  Proteins found in most exosomes
   Acel_1115
  Exosomal proteins of colorectal cancer cells
   Acel_1115
  Exosomal proteins of bladder cancer cells
   Acel_1115
  Exosomal proteins of melanoma cells
   Acel_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1237804..1239867
Genome map
AA seq 687 aa AA seqDB search
MRSVDDLEVAGRTVFVRVDLNVPLEATDQGPRITDDKRIQASLPTIRDLLGRGARVVLLA
HLGRPKGEVRPELSLRPVAARLAELLGEPVAFPDTTDGGVAGEAARALVAQLRPGQAALL
ENLRFEAAETSKDDAERAAFAERLIALAGEEGALYVGDGFGAVHRKHASVYDLPLRLPHA
AGRLVLAEVSVLRRLTENPDRPYVVVLGGAKVSDKLGVIANLLEKVDRLLIGGGMAYTFL
AAQGHEVGRSILEADQVDAVRGFLAEAEKRGVDLVLPVDIVAASHYAPDADHVVVPATAI
PADREGLDIGPQTRELFAAKLADARTVFWNGPMGVFEFDAFAAGTRAVAEAIARLDGLTV
IGGGDSAAAVRKLGFPESAFRHVSTGGGASLEYLEGKELPGLQALEADTRQGTAGPSGVG
GRHAVSRSGSPARKPLMAGNWKMHYTHLEAIAHVQKLAFILSEADYERVEVAVLPPFTAI
RSVQTLVDGDKLPIRYGAQDVSPYPSGAYTGDISAGMLAKLGCSYVIVGHSERRHYHHEN
DELINAKVRAVIGAEMTPILCVGEPLDVRRSGRHVEFTLGQLDADLAGLSAEQVASLVIA
YEPVWAIGTGEVATPKDAQEVCAAIRARLAESFGDAAARSARILYGGSVKSDNAGGIMEE
PDVDGALVGGASLDAEEFARIVRYDTK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtgtcgacgacctggaggtcgccggcaggacggtcttcgtccgggtcgacctc
aacgtgccgctggaagcaaccgatcagggcccacggatcaccgacgacaagcgcattcaa
gcgagcctgcccacgatccgtgacctgctcggccgtggtgcacgggttgtgctgctggcc
cacctcggccggcccaagggtgaggtccgcccggagctctccctccggccggttgcggca
cggctcgcggagctgcttggcgaaccggtcgctttccctgataccaccgacggcggggtt
gccggcgaagcggcgcgcgcgctcgtcgcgcagttacgccccgggcaggccgccctgctg
gagaacctccgcttcgaggcggcggagaccagcaaggacgacgccgagcgcgcggcgttt
gccgagcggctcatcgccctcgccggcgaggagggggcgctgtacgtcggcgacggcttc
ggcgccgtgcaccgcaagcacgccagcgtgtatgacctgccgctccgcctgccgcatgcc
gctggacgcctcgttctcgccgaggtgagcgtgctgcgccgcctcaccgagaaccccgac
cgtccgtacgtcgtcgtcctcggcggggcgaaggtctccgacaagctcggtgtcattgcc
aacctgctggagaaggtcgaccggcttctcatcggcggcggaatggcgtacaccttcctc
gccgcgcaagggcatgaagtcggccgttcgatcctcgaggcggatcaggtggacgccgtc
cgcggcttccttgccgaggcggagaagcgcggcgtggacctcgtccttccggtcgacatc
gtcgcggcgtcccattacgcgccggacgccgaccacgtcgtcgtgcccgcgaccgcgatc
ccggccgaccgcgaggggctggacatcggaccgcaaacccgcgagctcttcgccgccaag
ctggccgacgcccggaccgtgttctggaacggtccgatgggcgtcttcgaattcgacgcc
ttcgcggccggcacccgggcggtggccgaggcgatcgcccgtctcgacggtctcaccgtc
attggcggaggggactcggcagcggcggtacgcaaactcggattccctgagtccgcattc
cgtcacgtctcgaccgggggcggcgcaagcctggagtacctggaaggcaaggaactgccg
ggccttcaggcgttggaggccgacacaaggcaaggaactgccgggccttcaggcgttgga
ggccgacacgccgtgagccggtcgggatcgccggcccgcaaaccgctgatggccggcaac
tggaaaatgcactacacccatttggaagcgatcgcgcacgtccagaagttggccttcatc
ctctccgaggccgactacgagcgggtcgaggtcgccgtcctcccgccgttcacggcgatc
cgcagcgtccagacattggtggacggcgacaagctcccgatccgttacggcgctcaggac
gtctcgccgtatccctccggggcgtacaccggggacatctcagccggaatgctggccaag
ctcggctgcagctacgtgatcgtcggacattccgagcggcgtcactatcaccacgagaac
gacgagctgatcaacgcgaaggtgcgggcggtgatcggggctgagatgaccccgatcctc
tgcgttggtgaaccgcttgacgtgcgccggagcggcaggcacgtcgagttcaccctcggt
cagctggacgccgatctcgccggactctccgctgagcaggtcgcctcgctcgtcatcgcc
tacgaaccggtctgggccatcggcaccggtgaggtcgccacgccgaaggacgcccaggag
gtgtgcgcggcgatccgcgcccggctggccgagagcttcggtgacgccgcggcgcgatca
gcccggatcttgtacggcgggtcggtcaagagtgataatgccggcgggatcatggaggag
ccggatgtcgatggcgcactcgtgggcggcgcaagcctggacgccgaggagttcgcacgg
atcgtgcgatacgacacgaagtag

DBGET integrated database retrieval system