KEGG   Acidothermus cellulolyticus: Acel_1115Help
Entry
Acel_1115         CDS       T00426                                 

Definition
bifunctional phosphoglycerate kinase/triosephosphate isomerase (EC:2.7.2.3 5.3.1.1)
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_1115
   01230 Biosynthesis of amino acids
    Acel_1115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_1115
   00051 Fructose and mannose metabolism
    Acel_1115
   00562 Inositol phosphate metabolism
    Acel_1115
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Acel_1115
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acel_1115
Exosome [BR:ace04147]
 Exosomal proteins
  Proteins found in most exosomes
   Acel_1115
  Exosomal proteins of colorectal cancer cells
   Acel_1115
  Exosomal proteins of bladder cancer cells
   Acel_1115
  Exosomal proteins of melanoma cells
   Acel_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1237804..1239867
Genome map
AA seq 687 aa AA seqDB search
MRSVDDLEVAGRTVFVRVDLNVPLEATDQGPRITDDKRIQASLPTIRDLLGRGARVVLLA
HLGRPKGEVRPELSLRPVAARLAELLGEPVAFPDTTDGGVAGEAARALVAQLRPGQAALL
ENLRFEAAETSKDDAERAAFAERLIALAGEEGALYVGDGFGAVHRKHASVYDLPLRLPHA
AGRLVLAEVSVLRRLTENPDRPYVVVLGGAKVSDKLGVIANLLEKVDRLLIGGGMAYTFL
AAQGHEVGRSILEADQVDAVRGFLAEAEKRGVDLVLPVDIVAASHYAPDADHVVVPATAI
PADREGLDIGPQTRELFAAKLADARTVFWNGPMGVFEFDAFAAGTRAVAEAIARLDGLTV
IGGGDSAAAVRKLGFPESAFRHVSTGGGASLEYLEGKELPGLQALEADTRQGTAGPSGVG
GRHAVSRSGSPARKPLMAGNWKMHYTHLEAIAHVQKLAFILSEADYERVEVAVLPPFTAI
RSVQTLVDGDKLPIRYGAQDVSPYPSGAYTGDISAGMLAKLGCSYVIVGHSERRHYHHEN
DELINAKVRAVIGAEMTPILCVGEPLDVRRSGRHVEFTLGQLDADLAGLSAEQVASLVIA
YEPVWAIGTGEVATPKDAQEVCAAIRARLAESFGDAAARSARILYGGSVKSDNAGGIMEE
PDVDGALVGGASLDAEEFARIVRYDTK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagtgtcgacgacctggaggtcgccggcaggacggtcttcgtccgggtcgacctc
aacgtgccgctggaagcaaccgatcagggcccacggatcaccgacgacaagcgcattcaa
gcgagcctgcccacgatccgtgacctgctcggccgtggtgcacgggttgtgctgctggcc
cacctcggccggcccaagggtgaggtccgcccggagctctccctccggccggttgcggca
cggctcgcggagctgcttggcgaaccggtcgctttccctgataccaccgacggcggggtt
gccggcgaagcggcgcgcgcgctcgtcgcgcagttacgccccgggcaggccgccctgctg
gagaacctccgcttcgaggcggcggagaccagcaaggacgacgccgagcgcgcggcgttt
gccgagcggctcatcgccctcgccggcgaggagggggcgctgtacgtcggcgacggcttc
ggcgccgtgcaccgcaagcacgccagcgtgtatgacctgccgctccgcctgccgcatgcc
gctggacgcctcgttctcgccgaggtgagcgtgctgcgccgcctcaccgagaaccccgac
cgtccgtacgtcgtcgtcctcggcggggcgaaggtctccgacaagctcggtgtcattgcc
aacctgctggagaaggtcgaccggcttctcatcggcggcggaatggcgtacaccttcctc
gccgcgcaagggcatgaagtcggccgttcgatcctcgaggcggatcaggtggacgccgtc
cgcggcttccttgccgaggcggagaagcgcggcgtggacctcgtccttccggtcgacatc
gtcgcggcgtcccattacgcgccggacgccgaccacgtcgtcgtgcccgcgaccgcgatc
ccggccgaccgcgaggggctggacatcggaccgcaaacccgcgagctcttcgccgccaag
ctggccgacgcccggaccgtgttctggaacggtccgatgggcgtcttcgaattcgacgcc
ttcgcggccggcacccgggcggtggccgaggcgatcgcccgtctcgacggtctcaccgtc
attggcggaggggactcggcagcggcggtacgcaaactcggattccctgagtccgcattc
cgtcacgtctcgaccgggggcggcgcaagcctggagtacctggaaggcaaggaactgccg
ggccttcaggcgttggaggccgacacaaggcaaggaactgccgggccttcaggcgttgga
ggccgacacgccgtgagccggtcgggatcgccggcccgcaaaccgctgatggccggcaac
tggaaaatgcactacacccatttggaagcgatcgcgcacgtccagaagttggccttcatc
ctctccgaggccgactacgagcgggtcgaggtcgccgtcctcccgccgttcacggcgatc
cgcagcgtccagacattggtggacggcgacaagctcccgatccgttacggcgctcaggac
gtctcgccgtatccctccggggcgtacaccggggacatctcagccggaatgctggccaag
ctcggctgcagctacgtgatcgtcggacattccgagcggcgtcactatcaccacgagaac
gacgagctgatcaacgcgaaggtgcgggcggtgatcggggctgagatgaccccgatcctc
tgcgttggtgaaccgcttgacgtgcgccggagcggcaggcacgtcgagttcaccctcggt
cagctggacgccgatctcgccggactctccgctgagcaggtcgcctcgctcgtcatcgcc
tacgaaccggtctgggccatcggcaccggtgaggtcgccacgccgaaggacgcccaggag
gtgtgcgcggcgatccgcgcccggctggccgagagcttcggtgacgccgcggcgcgatca
gcccggatcttgtacggcgggtcggtcaagagtgataatgccggcgggatcatggaggag
ccggatgtcgatggcgcactcgtgggcggcgcaagcctggacgccgaggagttcgcacgg
atcgtgcgatacgacacgaagtag

DBGET integrated database retrieval system