KEGG   Acidothermus cellulolyticus: Acel_1293Help
Entry
Acel_1293         CDS       T00426                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00230  Purine metabolism
ace01100  Metabolic pathways
Module
ace_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Acel_1293
Enzymes [BR:ace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Acel_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 RsgA_GTPase AAA_29 MMR_HSR1 Rad17 AAA_5
Motif
Other DBs
NCBI-ProteinID: ABK53065
JGI: Acel1293
UniProt: A0LUF5
Position
complement(1442458..1443084)
Genome map
AA seq 208 aa AA seqDB search
MTGSPKGDAAGCRPVPLTVLSGPSGVGKGTVVAELSRRVPRLWVSVSVTTRAPRPGEIDG
RTYRFVDDTEFARMVAAGEFLEYARYGEHWYGTPRRPVEERVAAGIPVLLEIDLQGARQV
RAALPDAFAVFLAPPSWAELRRRLIGRGTEDDADVRARLKRAEVEMAAAGEFDAVVVNTS
VEQACQELITLLRLDGCPHEQPGPPSAP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggatcacctaagggcgacgccgccgggtgccggcccgttccgctgaccgtcctg
tccggaccatccggcgtcggcaaagggactgtcgtggccgagctctcccggcgggtgccc
aggctctgggtctcggtctcggtgaccacccgtgccccgcggccgggggaaatcgacggg
cgcacctaccgcttcgtcgacgacacggaatttgcccggatggtcgcggcgggtgaattc
ctcgaatatgcgcggtacggggagcactggtacggcacgccgcggcgtccggtcgaggag
cgggttgccgccgggatccccgtcctgctggagatcgacctgcagggcgcccggcaggtg
cgggccgcgttgccggacgcgttcgccgtcttccttgctccgccgagttgggcggaactg
cgccggcggctcatcggccgggggacggaggacgacgccgacgttcgtgcgcgcttgaaa
cgcgctgaggttgagatggctgcggccggggagtttgacgccgtcgtcgtcaacacgtcg
gtcgagcaggcctgtcaggagttgataaccttattgcgcttggacggttgtccgcatgag
caacccggtccgccgagtgcaccgtag

DBGET integrated database retrieval system