KEGG   Acidothermus cellulolyticus: Acel_1301Help
Entry
Acel_1301         CDS       T00426                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00240  Pyrimidine metabolism
ace00250  Alanine, aspartate and glutamate metabolism
ace01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acel_1301
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acel_1301
Enzymes [BR:ace01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acel_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABK53073
JGI: Acel1301
UniProt: A0LUG3
Position
complement(1452048..1453019)
Genome map
AA seq 323 aa AA seqDB search
MMRHLLSAGDLTRDDALLILDTAAELARLADRPIKKLPTLRGRTIVNLFYEDSTRTRTSF
EAAAKRLSADVINFSAKGSSVSKGESLKDTALTLEAMGTDAVVIRHWASGAPHRLAGWVR
GSVINAGDGTHEHPTQALLDAYTIRRHLGGVDGRRVAIVGDILHSRVARSNVTLLHTLGA
EVTLVAPPTLLPVGVESWPCAVSYELDGVLPKCDAVMLLRVQRERMQAAFFPTSREYSRR
YGLDAARLALLPEHAIVLHPGPMNRGVEIAAEVADSPRSVVVEQVANGVVVRMAVLYLLL
GGGEPALAGRAAEPAAAAIGGGW
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggcacctgctctcggctggcgacctgacccgcgacgacgcgctgctcatcctg
gacaccgcggcggaactggcgcggctggccgaccggccgatcaagaagctgccgaccctg
cggggacggacgatcgtcaacctgttctacgaagattccacccggacccggacctcgttc
gaagccgccgccaagcggctctccgctgacgtgatcaacttctccgcgaaggggtcgagc
gtctccaagggcgagagtctcaaggacacggcgctcaccctcgaagcgatgggtaccgac
gcggtcgtcattcgccattgggccagcggtgccccccatcgccttgccggctgggtccgc
ggctcggtgatcaatgcgggtgacggcacccacgagcatcccacccaggcgctcctcgac
gcgtacacgatccgacggcatctcggcggtgtggatgggcgccgggtggcgatcgtcggc
gacatcctgcacagccgggtcgcgcggtcgaacgtcacgttgctgcacaccctcggggcg
gaggtcaccctcgtcgcgccgccgaccctgctcccggtcggcgtggagagctggccgtgc
gcggtctcgtatgagctggacggcgtactgccgaagtgcgacgccgtcatgctgctccgg
gtacagcgggagcggatgcaggcggccttcttccccacctcgcgggagtacagccgccgg
tatgggctggacgccgcccgcctcgcgctgctgccggagcacgcgatcgtgctccacccg
ggaccgatgaaccggggcgtcgagatcgccgcagaagtcgcggattcgccacggtcggtg
gtggtcgagcaagtcgccaacggggtcgtcgtgcggatggccgtgctctacctcctcctt
ggcgggggtgagcccgcgctggccggacgggcggccgaaccggccgcggccgcgatcggg
ggtggctggtga

DBGET integrated database retrieval system