KEGG   Acidothermus cellulolyticus: Acel_1381Help
Entry
Acel_1381         CDS       T00426                                 

Definition
UDP-galactopyranose mutase (EC:5.4.99.9)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ace  Acidothermus cellulolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acel_1381
Enzymes [BR:ace01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Acel_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1538898..1540289)
Genome map
AA seq 463 aa AA seqDB search
MTARIVVVGGGIAGLSAAFYARRRGFSVTVLEGSKRFGGKLLRAEVAGVSTDLGAEALLA
RRPEAVDLAREVGLGGELVPPATTQAAVYSRGRLRPLPAGHVMGVPRSLRSLAATGIVPP
TAVLRAAADLLLPPTPVGDDVPVARGIGIRLGRGVVDRLVEPLLGGVYAGRADRLSLRAT
LPQLVDVLDRGSLLRGLRDLPPPGGADPVFAGIPGGVARLGEALVDVLRADGVELRTSAM
VRVLRRTPTGWRCDVGPASAPEAVDADGVVVAVPAPAAARMLGPEAGGLAAELAGIEYAS
VAVVTLAFPADQVNLPAGSGFLVPAVERRLVKAATFSSVKWPWYAGSDVAVVRCSIGRFG
DTADLQRDDAELVAGVLADLGAIVRLRAQPIDSIVTRWAGALPQYDVGHAARVARIRSAA
ARLPGFALCGAAYDGVGIPACIAGAQRAVASLTGPRSVSRTAG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcggatcgtcgtcgtcggcggcggcatcgccgggctgagcgcagccttctac
gcccggcgccgcggattctccgtcaccgtcctggaagggtcgaaacggttcggcggcaag
ctgctccgcgccgaggtggccggtgtgagcacggaccttggggctgaggcgttgctggca
cggcgtccggaagcggtcgatctcgcgcgcgaggtgggtcttggtggcgagctcgttccg
ccggcgaccacccaggctgcggtctactcccgtggccggctccggccgctaccggccggc
catgtcatgggcgtgccgcggagccttcgcagccttgccgctaccgggatcgtgccgccg
accgccgtcctgcgggcagccgccgacctcctcctgcccccgactccggtcggtgacgac
gtccccgtcgcccgcgggatcgggatccggctcggccgtggtgtcgtcgaccggctggtt
gaaccgctcctcggcggggtgtacgccgggcgtgccgaccggctctccctgcgggccacc
ctgccgcagctggtcgacgtcctcgatcgcggctcgctcctgcgcggcctgcgggacctg
ccgccgccgggtggcgccgacccagtcttcgccgggattcccggcggcgtggcccggctc
ggcgaggcgctcgtcgacgtgttgcgcgcggacggcgtcgagctgcggacctcggcgatg
gtccgggtgttgcggcgcacgccgacgggttggcggtgcgacgtcgggccggcgagcgcg
ccggaggcggtggacgcggatggcgtggtggttgccgtgccggcgccggcggccgcccgg
atgctcgggccggaggccgggggtcttgcggctgaactggccgggattgagtacgccagc
gtcgccgtcgtcacgctggccttcccggcggatcaggtgaatctgcctgccggaagcgga
ttcttggttccggcggtggaacggcggctcgtcaaggcggccacgttctcgtcagtgaaa
tggccctggtacgccggttcggacgttgccgtcgtccgctgttcgatcggccggttcggt
gacaccgccgacctgcagcgtgacgacgccgagctcgtcgccggcgtgctcgctgacctg
ggcgcgatcgttaggctgcgggcgcaaccgatcgattcgatcgtcacccggtgggccggc
gcactcccgcagtacgacgtcggccatgccgcccgtgtcgcccgcatccgcagcgccgcg
gctcggctgcccggttttgcgctctgcggcgcggcgtatgacggtgtcggcattccggcg
tgcatcgcgggcgcgcagcgggcggtggcgtcgctgaccgggccgcggtcggtgtcgcga
acggctggatga

  All links  
No link information was found.   
DBGET integrated database retrieval system