KEGG   Acidothermus cellulolyticus: Acel_1742Help
Entry
Acel_1742         CDS       T00426                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ace  Acidothermus cellulolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acel_1742
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Acel_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1967115..1968422)
Genome map
AA seq 435 aa AA seqDB search
MINQVGGVPPLTGFTVAITAERRREELAELLRRRGARVRVVSTLRTVFADDAEIAAATEE
ALTGPVDIVIVTTAVGFRRWLESADGLGYGDRLRMALWSADLVARGAKARGAVRAAGLPE
TSPPVETMSEIVEFLRARGVCGKRVVVQAHGDPDDRTASALCRDGAEVVVVPVYHWSSAD
AARAERLAGDIVTGRLDAVVFTSRPACDGLLRASGDAREHVIDAFRAGVVAACIGPVCAQ
PLVDAGVDVVMPPRGRLGDLVRAVTEEVPRRRTLSTAIGNQRLEVRGHGVVYGEAFTVLP
PAPLAVLRALVANAGRVVTKSALAAAIGTAVGRQQPSQALKRLEHRRVEMAVARLRRAVP
HIPVTAVIKRGYRLAQPGSEGVVFVTGKGDVDRSHAPMPDEEATPGRHPAVASRHANPEE
VTVERTTWVEEHSAP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcaggtcggcggtgtgcccccgctgaccggtttcaccgttgcaattaccgct
gagcgtcgccgggaggagcttgccgagctcctgcggaggaggggcgcccgggtaagagtg
gtgagcacgttacgcaccgtcttcgcggatgacgccgaaattgccgcggccaccgaggaa
gcgctcactgggcctgtggacattgttatcgtgacgacagctgtcggttttcgccgttgg
ctggagagcgcggacggccttggctacggcgacagactgcggatggctctgtggagcgct
gaccttgtcgcccgcggcgcgaaggcacgcggagctgtccgcgccgccggattgcccgaa
acgtcccccccggtcgagacgatgtcggagatcgtggagtttctccgggcgcgtggcgtc
tgcggcaaacgcgtcgtggtgcaggcgcacggtgatccggacgaccgaacagcgtcggct
ctttgccgcgatggtgccgaggtggtcgtcgtcccggtgtatcactggtcgtcggctgat
gccgcacgtgcggagcggcttgccggcgatatcgtgaccggccggctcgatgcggtggtt
ttcaccagccgacccgcatgtgacgggcttctgcgggcgtccggcgacgcgcgcgagcac
gtgattgacgcctttcgcgcgggtgttgttgccgcgtgcatcggcccggtatgtgcgcag
ccgcttgtcgacgccggcgttgacgtcgtcatgccgccgcggggccggctcggcgacctg
gtgcgcgccgtgacagaagaggtgccgaggaggcggacgctgtccacggcaatcggcaac
cagcgcctcgaggtacggggtcacggcgtcgtttacggggaggcctttaccgtgctaccg
cccgcgccgttggcggtcttgcgggccttggtcgcgaatgccggtcgtgtggtcacgaaa
tcggcgctggccgcggcgatcggtacggcggtaggtcgccagcaaccgagtcaggcactc
aaacggctggagcatcggcgggtagaaatggcagtcgctcgactacgacgtgcagtgccg
cacatacccgttaccgctgttatcaaacgcgggtatcgtcttgcccagcctgggagcgaa
ggtgttgttttcgtcaccggcaagggcgacgtggaccggagtcatgcgcccatgccggat
gaggaagccacgcccgggcggcatccggccgtggcttctcggcatgcgaatcccgaagag
gtcaccgtcgagcggactacgtgggtcgaggagcactccgctccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system