KEGG   Acidothermus cellulolyticus: Acel_1879Help
Entry
Acel_1879         CDS       T00426                                 

Gene name
fumC
Definition
fumarate hydratase (EC:4.2.1.2)
Orthology
K01679  
fumarate hydratase, class II [EC:4.2.1.2]
Organism
ace  Acidothermus cellulolyticus
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acel_1879 (fumC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_1879 (fumC)
   00620 Pyruvate metabolism
    Acel_1879 (fumC)
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Acel_1879 (fumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2123940..2125358
Genome map
AA seq 472 aa AA seqDB search
MTAGALGDAFRVEHDSMGEVRVPAHAKWRAQTQRAVENFPISGMRIDRELIAALAAIKGA
AARVNAELGVIDPDVASAIAEAAEEVRHGQWDDHFPVDVFQTGSGTSSNMNANEVIATLA
AERLGRPIHPNDHVNASQSSNDTFPSAIHIAACRAVTGTLLPALEHLAAALERKATEFAD
VVKAGRTHLMDATPVTLGQEFSGYSAAVRYGMERLRSVLPRLGELPLGGTAVGTGINTPP
GFAARVIERLASQLQLPLTEARNHFEAQGARDALVETSGMLRVVAVSLYKIANDLRLMAS
GPRTGLAEIHLPDLQPGSSIMPGKVNPVIPEAVCQVAAQVIGNDATVAFGGAAGTLELNV
MLPVIARNLLESIRLLSNVARLFADRCVAGITADVERCRRYAESSPAIVTPLNRYIGYEA
AAKVAKYALEHDTTIRQAVIDCGFVANGQISEAQLDRVLDVLAMTGRPVTAD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggtgcgttgggtgacgcttttcgtgtcgagcacgattcgatgggtgaggtc
cgcgttccggcccatgccaagtggcgcgcacaaacacaacgcgcggtcgagaatttcccg
atttccggaatgcggatcgaccgtgagctgattgccgctctcgcggccatcaaaggcgca
gccgcacgcgtcaacgccgaactcggcgtcatcgaccccgatgtggcgagcgcgattgcg
gaggcggccgaggaagtgcgccacggtcagtgggacgaccatttccccgtcgacgtcttt
caaaccggctccggtacgtcaagcaacatgaatgccaatgaagtcatcgcgactctggcc
gcggaacggcttggtcgcccgattcatcccaacgaccacgtgaacgcctcgcagtcatcg
aacgacacctttccatcggccattcacatcgcggcgtgccgggccgtcaccggcaccctc
cttcccgcgttggagcatctcgccgccgcactcgaacgcaaagcaacggagttcgccgac
gtcgtgaaggccggacgcacccacctgatggacgccacaccggtcacgctcggacaggaa
ttcagcggatattcggccgccgtccgttacgggatggaacggctgcggagcgtgctgccg
cgacttggcgagctgccgctcggcggtacggcggtgggaacgggaatcaatactcctccc
ggattcgccgcacgggtcatcgaacggctcgcgtcccagctccagttgccgctcaccgaa
gcacgcaatcattttgaagcccagggcgcccgcgatgcgctggtggaaacgagcggcatg
ctgcgggttgtcgcggtcagcctgtacaaaatcgccaatgacttacggctgatggcctcc
ggtccgcgcaccggactcgccgagatccacctgccggacctgcagccaggttcatccatc
atgcccgggaaggtgaatcccgtcatcccggaagcggtctgccaggtcgcggctcaagtc
atcggcaacgacgcgacggtggcgttcggcggcgccgctggcaccctggaactgaacgtg
atgcttccggttattgcccgcaatctgctggaatcgatccggctgctctccaacgtcgct
cgtctctttgcggatcggtgcgtcgctggtatcaccgcggacgtcgaacgctgccgccga
tacgccgaatcgtcgcctgccatcgttaccccgctgaatcggtacatcggatacgaggcg
gcggcgaaggtggcgaaatatgcgctggagcacgacacgacgatccggcaggcggtcatt
gactgcggattcgttgccaacgggcagatcagtgaagcccagttggaccgggtgttggac
gttctcgccatgaccggccgcccggtgacggcggattga

DBGET integrated database retrieval system