KEGG   Acidothermus cellulolyticus: Acel_1879Help
Entry
Acel_1879         CDS       T00426                                 

Definition
(GenBank) fumarase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00020  Citrate cycle (TCA cycle)
ace00620  Pyruvate metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acel_1879
   00620 Pyruvate metabolism
    Acel_1879
Enzymes [BR:ace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Acel_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C NIR_SIR_ferr
Motif
Other DBs
NCBI-ProteinID: ABK53651
JGI: Acel1879
UniProt: A0LW41
Position
2123940..2125358
Genome map
AA seq 472 aa AA seqDB search
MTAGALGDAFRVEHDSMGEVRVPAHAKWRAQTQRAVENFPISGMRIDRELIAALAAIKGA
AARVNAELGVIDPDVASAIAEAAEEVRHGQWDDHFPVDVFQTGSGTSSNMNANEVIATLA
AERLGRPIHPNDHVNASQSSNDTFPSAIHIAACRAVTGTLLPALEHLAAALERKATEFAD
VVKAGRTHLMDATPVTLGQEFSGYSAAVRYGMERLRSVLPRLGELPLGGTAVGTGINTPP
GFAARVIERLASQLQLPLTEARNHFEAQGARDALVETSGMLRVVAVSLYKIANDLRLMAS
GPRTGLAEIHLPDLQPGSSIMPGKVNPVIPEAVCQVAAQVIGNDATVAFGGAAGTLELNV
MLPVIARNLLESIRLLSNVARLFADRCVAGITADVERCRRYAESSPAIVTPLNRYIGYEA
AAKVAKYALEHDTTIRQAVIDCGFVANGQISEAQLDRVLDVLAMTGRPVTAD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggtgcgttgggtgacgcttttcgtgtcgagcacgattcgatgggtgaggtc
cgcgttccggcccatgccaagtggcgcgcacaaacacaacgcgcggtcgagaatttcccg
atttccggaatgcggatcgaccgtgagctgattgccgctctcgcggccatcaaaggcgca
gccgcacgcgtcaacgccgaactcggcgtcatcgaccccgatgtggcgagcgcgattgcg
gaggcggccgaggaagtgcgccacggtcagtgggacgaccatttccccgtcgacgtcttt
caaaccggctccggtacgtcaagcaacatgaatgccaatgaagtcatcgcgactctggcc
gcggaacggcttggtcgcccgattcatcccaacgaccacgtgaacgcctcgcagtcatcg
aacgacacctttccatcggccattcacatcgcggcgtgccgggccgtcaccggcaccctc
cttcccgcgttggagcatctcgccgccgcactcgaacgcaaagcaacggagttcgccgac
gtcgtgaaggccggacgcacccacctgatggacgccacaccggtcacgctcggacaggaa
ttcagcggatattcggccgccgtccgttacgggatggaacggctgcggagcgtgctgccg
cgacttggcgagctgccgctcggcggtacggcggtgggaacgggaatcaatactcctccc
ggattcgccgcacgggtcatcgaacggctcgcgtcccagctccagttgccgctcaccgaa
gcacgcaatcattttgaagcccagggcgcccgcgatgcgctggtggaaacgagcggcatg
ctgcgggttgtcgcggtcagcctgtacaaaatcgccaatgacttacggctgatggcctcc
ggtccgcgcaccggactcgccgagatccacctgccggacctgcagccaggttcatccatc
atgcccgggaaggtgaatcccgtcatcccggaagcggtctgccaggtcgcggctcaagtc
atcggcaacgacgcgacggtggcgttcggcggcgccgctggcaccctggaactgaacgtg
atgcttccggttattgcccgcaatctgctggaatcgatccggctgctctccaacgtcgct
cgtctctttgcggatcggtgcgtcgctggtatcaccgcggacgtcgaacgctgccgccga
tacgccgaatcgtcgcctgccatcgttaccccgctgaatcggtacatcggatacgaggcg
gcggcgaaggtggcgaaatatgcgctggagcacgacacgacgatccggcaggcggtcatt
gactgcggattcgttgccaacgggcagatcagtgaagcccagttggaccgggtgttggac
gttctcgccatgaccggccgcccggtgacggcggattga

DBGET integrated database retrieval system