KEGG   Acidothermus cellulolyticus: Acel_1879Help
Entry
Acel_1879         CDS       T00426                                 

Gene name
fumC
Definition
fumarate hydratase (EC:4.2.1.2)
Orthology
K01679  
fumarate hydratase, class II [EC:4.2.1.2]
Organism
ace  Acidothermus cellulolyticus
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ace01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ace00020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2123940..2125358
Genome map
AA seq 472 aa AA seqDB search
MTAGALGDAFRVEHDSMGEVRVPAHAKWRAQTQRAVENFPISGMRIDRELIAALAAIKGA
AARVNAELGVIDPDVASAIAEAAEEVRHGQWDDHFPVDVFQTGSGTSSNMNANEVIATLA
AERLGRPIHPNDHVNASQSSNDTFPSAIHIAACRAVTGTLLPALEHLAAALERKATEFAD
VVKAGRTHLMDATPVTLGQEFSGYSAAVRYGMERLRSVLPRLGELPLGGTAVGTGINTPP
GFAARVIERLASQLQLPLTEARNHFEAQGARDALVETSGMLRVVAVSLYKIANDLRLMAS
GPRTGLAEIHLPDLQPGSSIMPGKVNPVIPEAVCQVAAQVIGNDATVAFGGAAGTLELNV
MLPVIARNLLESIRLLSNVARLFADRCVAGITADVERCRRYAESSPAIVTPLNRYIGYEA
AAKVAKYALEHDTTIRQAVIDCGFVANGQISEAQLDRVLDVLAMTGRPVTAD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccggtgcgttgggtgacgcttttcgtgtcgagcacgattcgatgggtgaggtc
cgcgttccggcccatgccaagtggcgcgcacaaacacaacgcgcggtcgagaatttcccg
atttccggaatgcggatcgaccgtgagctgattgccgctctcgcggccatcaaaggcgca
gccgcacgcgtcaacgccgaactcggcgtcatcgaccccgatgtggcgagcgcgattgcg
gaggcggccgaggaagtgcgccacggtcagtgggacgaccatttccccgtcgacgtcttt
caaaccggctccggtacgtcaagcaacatgaatgccaatgaagtcatcgcgactctggcc
gcggaacggcttggtcgcccgattcatcccaacgaccacgtgaacgcctcgcagtcatcg
aacgacacctttccatcggccattcacatcgcggcgtgccgggccgtcaccggcaccctc
cttcccgcgttggagcatctcgccgccgcactcgaacgcaaagcaacggagttcgccgac
gtcgtgaaggccggacgcacccacctgatggacgccacaccggtcacgctcggacaggaa
ttcagcggatattcggccgccgtccgttacgggatggaacggctgcggagcgtgctgccg
cgacttggcgagctgccgctcggcggtacggcggtgggaacgggaatcaatactcctccc
ggattcgccgcacgggtcatcgaacggctcgcgtcccagctccagttgccgctcaccgaa
gcacgcaatcattttgaagcccagggcgcccgcgatgcgctggtggaaacgagcggcatg
ctgcgggttgtcgcggtcagcctgtacaaaatcgccaatgacttacggctgatggcctcc
ggtccgcgcaccggactcgccgagatccacctgccggacctgcagccaggttcatccatc
atgcccgggaaggtgaatcccgtcatcccggaagcggtctgccaggtcgcggctcaagtc
atcggcaacgacgcgacggtggcgttcggcggcgccgctggcaccctggaactgaacgtg
atgcttccggttattgcccgcaatctgctggaatcgatccggctgctctccaacgtcgct
cgtctctttgcggatcggtgcgtcgctggtatcaccgcggacgtcgaacgctgccgccga
tacgccgaatcgtcgcctgccatcgttaccccgctgaatcggtacatcggatacgaggcg
gcggcgaaggtggcgaaatatgcgctggagcacgacacgacgatccggcaggcggtcatt
gactgcggattcgttgccaacgggcagatcagtgaagcccagttggaccgggtgttggac
gttctcgccatgaccggccgcccggtgacggcggattga

DBGET integrated database retrieval system