KEGG   Acidothermus cellulolyticus: Acel_1984Help
Entry
Acel_1984         CDS       T00426                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ace  Acidothermus cellulolyticus
Pathway
ace00010  Glycolysis / Gluconeogenesis
ace00620  Pyruvate metabolism
ace00640  Propanoate metabolism
ace00680  Methane metabolism
ace01100  Metabolic pathways
ace01110  Biosynthesis of secondary metabolites
ace01120  Microbial metabolism in diverse environments
ace01130  Biosynthesis of antibiotics
ace01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ace00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acel_1984
   00620 Pyruvate metabolism
    Acel_1984
   00640 Propanoate metabolism
    Acel_1984
  Energy metabolism
   00680 Methane metabolism
    Acel_1984
Enzymes [BR:ace01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Acel_1984
Lipid biosynthesis proteins [BR:ace01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Acel_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABK53756
JGI: Acel1984
UniProt: A0LWE6
Position
2259825..2261798
Genome map
AA seq 657 aa AA seqDB search
MSATSPTLANLLHEQRRFDPPPELAANAIATASIYEEAARDRLAFWAAQAERLTWATPWE
QVLDWSDAPFARWFVGGRLNAAVNCLDRHVAAGYGGKVAFYWEGEPGDTRVITYAELTAM
VCQAANALTELGVTAGDRVMIYMPMIPETVVAMLACARIGAVHSVVFGGFSAEALAGRTN
DAQARLIITADGGFRRGAAHALKPAVDDACAQCPQVDKVLVVRRTGQDIPWNDGRDIWWH
DIVDRQPSTHEAQAFDAEHPLYIMYTSGTTAKPKGILHTTGGYLTGVTATHRMVFDLHED
TDLYWCGADIGWVTGHSYIVYGPLANRATSFMYEGTPDTPAKDRWWQMIEKYRVSILYTA
PTTIRTFMKWGEEWPAKHDLSSLRVLGSVGEPINPEAWIWYRTHIGGNRCPIVDTWWQTE
TGSIMITPLPGVTSTKPGAAMRAFPGITVDVVDNDGNPVPNGSGGYLVITEPWPSMLRGI
WGDPQRYIDTYWSRFPGKYFAGDGAKRDEDGDIWLLGRVDDVMNVSGHRISTTEVEHALV
SHPKVAEAAVVGTHDPVTGQAIVAFVTVKGSVPADEAQGAAFAAELRAHVAKEIGPIAKP
RDILITADLPKTRSGKIMRRLLRDIADHRELGDTTTLLDPGVVQQIAAQLAGSGNEE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgacttccccgaccctagccaacctgctgcacgaacagcgccgctttgatcca
ccaccggaactcgccgcgaacgccatcgcgacggcgtccatttacgaggaggccgcgcgg
gaccggctggcgttctgggccgcgcaggccgagcggctcacgtgggcgacgccttgggaa
caggtgctcgactggagcgacgcgcccttcgcccgatggttcgtgggcggtcggctgaac
gccgcggtgaactgcctcgaccggcacgtcgcagcgggttacggcgggaaggtggcgttc
tactgggagggcgaacctggtgacacccgggtcatcacctacgccgagctcaccgcgatg
gtctgccaggccgcaaacgcgctcaccgagctgggtgtcaccgccggcgaccgggtcatg
atctacatgccgatgatcccggagacggtcgtcgccatgctcgcgtgcgcccggatcggg
gcggtgcattcggtggtcttcggtggcttctccgcggaagcgctcgctggcaggaccaat
gacgcgcaagctcggctcatcatcaccgcggacggcggtttccgccgcggtgcggcgcat
gccctcaaaccggcggtcgacgacgcgtgcgcgcagtgtccgcaagtggacaaggtgctc
gtcgtacgccgtacgggtcaggacattccctggaatgacggacgcgatatctggtggcat
gacatcgtcgaccgtcaaccgtccacccacgaggcgcaagcattcgacgccgagcatccg
ctgtacatcatgtacaccagtggcacaacggccaagccaaagggaattctgcataccacc
gggggttacctgaccggcgtgaccgcaacgcaccgcatggtcttcgacctgcacgaggac
acggatttgtattggtgcggagcagatatcggttgggtcacggggcacagttacatcgtg
tacgggccgctcgccaaccgggcgacgtcgttcatgtacgaaggcaccccggacacgccg
gcgaaagaccgctggtggcaaatgattgagaaataccgggtttcgatcctctacaccgcg
ccgaccacgatccgcacgttcatgaagtggggggaggaatggccggcgaaacacgacctg
tcgtcgctgcgcgtgctgggcagcgtcggtgaacccatcaatccggaagcgtggatctgg
taccgcacccatatcggcgggaatcgctgccccatcgtcgacacgtggtggcagacggag
accggaagcatcatgattaccccactgccgggcgtcacctcgaccaaaccgggcgcggcg
atgcgggcgttccccggcatcaccgtggacgtcgtcgacaacgacggaaaccccgtcccg
aacggcagcggcggctatctcgtcatcaccgaaccgtggccgtcaatgctccgcggaatc
tggggcgatccgcagcggtacatcgacacctactggtcgcggtttcccggcaaatacttc
gccggcgacggcgcgaaacgcgacgaagacggcgacatctggctgctcggccgtgtcgat
gacgtcatgaatgtctcgggccatcggatttcgacgaccgaagtggagcacgcccttgtc
tcgcacccgaaagtcgccgaggccgccgtggtcggcacccatgaccccgtgaccggtcaa
gccattgtcgcgttcgtcacggttaagggatcggtaccggcggacgaggcgcagggagct
gcttttgccgcggagctgcgggcgcacgtggccaaggagattgggccgatcgcgaagccg
agggacattctcatcaccgccgacctgcccaagacccggtccggcaaaatcatgcgccga
ctgctccgggacatcgccgaccatcgcgaactcggcgacacgacgacactccttgatccg
ggcgtcgtccagcagatcgcagcacagctggccggcagcggaaacgaggagtaa

DBGET integrated database retrieval system