KEGG   Atta cephalotes (leaf cutting ant): 105620473Help
Entry
105620473         CDS       T04923                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
acep  Atta cephalotes (leaf cutting ant)
Brite
Enzymes [BR:acep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105620473
Peptidases [BR:acep01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   105620473
Exosome [BR:acep04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105620473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 359 aa AA seqDB search
MMSMYLLLAAIIPIVILEIWYMGICLTWTMRTSILIYLIIFGLLPVIFHYSYTLQKKILF
LNFVHWPLKVEFSNPKLVGLEGARNFYLHTDQQVKIGAWQILPRSLLKNSIPATDEAYES
VLSNAKLPVFLYMHGNSGNRASSHRLELYKLFQDLDYHVICFDYRNYGDSDIVELSEEGV
IMDSKYVLEWVMKKVNGSVPVFVWGHSLGTGVSTHVLALLAAENIQPTGLFLEAPFNNIQ
DELTEHPFAQIFKHLPWFHWMAVEPFYKNNLRFESDKHIIKIDCPIMILHAEDDGVIPVF
LAEKLYQAALDSFGNNTNRIQMIKIDSSYGLGHKYICRYKKLPDIIKTFVVKAFGNLTE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgatgtacctactattagcagcaataataccaatcgtcatccttgagatttgg
tacatgggaatatgcttaacttggaccatgaggacctctatactgatatatcttattata
tttgggcttctaccagtaatttttcattactcttatactcttcaaaaaaagatacttttt
ttaaattttgtacattggccacttaaagtagagttttccaatccaaaattggttgggttg
gaaggcgctagaaatttttatttacataccgatcagcaagtaaagataggtgcatggcag
atattaccacggtctttattaaagaattccattcctgcgacagatgaagcttatgaatca
gttttaagtaatgctaagttacctgtatttctgtacatgcacggaaacagtggtaataga
gcaagttcacacaggctcgagctttataagcttttccaagatctggattatcatgttata
tgttttgattacagaaactatggcgatagcgatatagtagagctctccgaagaaggtgta
attatggatagtaaatatgttcttgagtgggtgatgaaaaaagttaatggttcagttcca
gtttttgtttggggtcactctctaggaactggagtttcgacgcatgtattagctctgcta
gcagccgaaaatatacaaccaacaggattatttctggaagcaccattcaataatatacaa
gatgaattaacagagcatccatttgcacaaatatttaaacacttaccatggttccattgg
atggctgttgaaccgttttataagaataatttgcgatttgagtctgataaacatattatt
aagattgattgtcctattatgatactacatgctgaagatgatggtgtaattccagttttc
ttagcagaaaagctttatcaagcagcattagatagttttggaaataatacaaatcgtatc
cagatgataaaaatagattcatcctatggacttggacataaatatatctgtagatacaaa
aaattacctgatataattaagacatttgtcgtcaaagcattcggaaatctgactgaataa

DBGET integrated database retrieval system