KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0401Help
Entry
AciM339_0401      CDS       T02396                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:acf00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:acf00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(346317..347492)
Genome map
AA seq 391 aa AA seqDB search
MLWMRYGPMLVCTKCGERYDLSSPIQRCSRCGEPLQLDFARGYVREGRSVWSRFGDFYPD
VHLNMDYSMGEGDTPLLFSRRISRKLGNDIYLKNESQNPTWSFKDRGTFVALNRAISLGF
EKIGVVSTGNMAASVSAYGARAGLETYVLLHSGTSIDRVAQISVYGSKVILVEGDYGTLY
YESIGIGTREGIYFMNSDDPFRVEGYKSIAFEIGETVEADYVVIPTSSGGLLRGIMKGFE
ELRNSGIIDRIPVPVAVQAEGCAPICRAFHNGTQVERFDGPRTIAHAISNPYPPSGNEVL
RLLKRYGGTCISVSDEDIINAQMDLAHEGIFVQPASATVLAAATHLKVRDKKIVLVLTGS
GLKAKMEYHGRIYQCELKDLERLLEVIENES
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctctggatgagatacgggcccatgcttgtttgtacaaaatgtggcgagagatacgac
ctctcctctccaattcaaagatgctccaggtgtggtgagccgcttcaactggattttgca
cggggatatgttcgggaaggcaggagtgtatggagcaggtttggtgatttctatccagat
gtgcatctgaacatggattacagcatgggagagggagatactcctctcctattttccaga
aggatatcccgaaaacttgggaacgatatttatttgaaaaatgaatcgcagaaccccacc
tggagtttcaaggacaggggaactttcgtggcactaaatcgtgcaatctccctcggattt
gaaaaaataggggttgtttcaacggggaacatggctgcaagcgtatccgcctacggtgcc
agagcgggacttgaaacctacgttctccttcattccggcacgtccatagatagggtggcc
cagatatcagtgtacggatccaaggtaattctggttgagggtgactatggaaccctctac
tatgaatccatagggattggaacccgagagggcatttattttatgaactcggacgatcct
ttcagggttgaggggtacaagagcatagcctttgaaattggagagaccgttgaggccgat
tatgtggtgattcccacgagttctggcggcttacttaggggaataatgaagggctttgaa
gagttgagaaacagcggtattatagataggattccagtgcccgtggccgttcaggcagag
gggtgtgcccccatttgcagggcattccacaacggtactcaggttgaaagatttgatggg
ccaagaacaatcgcacatgccatttcaaatccgtatcctcccagtggaaacgaggtattg
aggttgctcaaaaggtacggaggtacctgcatatctgtttcagatgaggatataattaat
gctcaaatggaccttgcccatgagggaatattcgtgcagccagcatccgccacagtcctg
gctgctgccacgcatctgaaagtaagggacaaaaagattgtgcttgtactcaccggttcc
gggctaaaggcaaaaatggaatatcatggacgcatataccaatgcgaactcaaagatctt
gagagacttttggaggtgatagaaaatgaatcctga

DBGET integrated database retrieval system