KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0401Help
Entry
AciM339_0401      CDS       T02396                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
acf00260  Glycine, serine and threonine metabolism
acf00750  Vitamin B6 metabolism
acf01100  Metabolic pathways
acf01110  Biosynthesis of secondary metabolites
acf01120  Microbial metabolism in diverse environments
acf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AciM339_0401
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AciM339_0401
Enzymes [BR:acf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AciM339_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 DZR ADK_lid DUF1451 HypA Zn-ribbon_8 Zn_ribbon_SprT
Motif
Other DBs
NCBI-ProteinID: AGB04290
UniProt: L0HJU1
Position
complement(346317..347492)
Genome map
AA seq 391 aa AA seqDB search
MLWMRYGPMLVCTKCGERYDLSSPIQRCSRCGEPLQLDFARGYVREGRSVWSRFGDFYPD
VHLNMDYSMGEGDTPLLFSRRISRKLGNDIYLKNESQNPTWSFKDRGTFVALNRAISLGF
EKIGVVSTGNMAASVSAYGARAGLETYVLLHSGTSIDRVAQISVYGSKVILVEGDYGTLY
YESIGIGTREGIYFMNSDDPFRVEGYKSIAFEIGETVEADYVVIPTSSGGLLRGIMKGFE
ELRNSGIIDRIPVPVAVQAEGCAPICRAFHNGTQVERFDGPRTIAHAISNPYPPSGNEVL
RLLKRYGGTCISVSDEDIINAQMDLAHEGIFVQPASATVLAAATHLKVRDKKIVLVLTGS
GLKAKMEYHGRIYQCELKDLERLLEVIENES
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctctggatgagatacgggcccatgcttgtttgtacaaaatgtggcgagagatacgac
ctctcctctccaattcaaagatgctccaggtgtggtgagccgcttcaactggattttgca
cggggatatgttcgggaaggcaggagtgtatggagcaggtttggtgatttctatccagat
gtgcatctgaacatggattacagcatgggagagggagatactcctctcctattttccaga
aggatatcccgaaaacttgggaacgatatttatttgaaaaatgaatcgcagaaccccacc
tggagtttcaaggacaggggaactttcgtggcactaaatcgtgcaatctccctcggattt
gaaaaaataggggttgtttcaacggggaacatggctgcaagcgtatccgcctacggtgcc
agagcgggacttgaaacctacgttctccttcattccggcacgtccatagatagggtggcc
cagatatcagtgtacggatccaaggtaattctggttgagggtgactatggaaccctctac
tatgaatccatagggattggaacccgagagggcatttattttatgaactcggacgatcct
ttcagggttgaggggtacaagagcatagcctttgaaattggagagaccgttgaggccgat
tatgtggtgattcccacgagttctggcggcttacttaggggaataatgaagggctttgaa
gagttgagaaacagcggtattatagataggattccagtgcccgtggccgttcaggcagag
gggtgtgcccccatttgcagggcattccacaacggtactcaggttgaaagatttgatggg
ccaagaacaatcgcacatgccatttcaaatccgtatcctcccagtggaaacgaggtattg
aggttgctcaaaaggtacggaggtacctgcatatctgtttcagatgaggatataattaat
gctcaaatggaccttgcccatgagggaatattcgtgcagccagcatccgccacagtcctg
gctgctgccacgcatctgaaagtaagggacaaaaagattgtgcttgtactcaccggttcc
gggctaaaggcaaaaatggaatatcatggacgcatataccaatgcgaactcaaagatctt
gagagacttttggaggtgatagaaaatgaatcctga

DBGET integrated database retrieval system