KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0515Help
Entry
AciM339_0515      CDS       T02396                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciM339_0515
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciM339_0515
   00052 Galactose metabolism
    AciM339_0515
   00500 Starch and sucrose metabolism
    AciM339_0515
   00520 Amino sugar and nucleotide sugar metabolism
    AciM339_0515
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AciM339_0515
   00524 Butirosin and neomycin biosynthesis
    AciM339_0515
Enzymes [BR:acf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AciM339_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(447379..448179)
Genome map
AA seq 266 aa AA seqDB search
MVLGIDVGGTKILAARVEDGKILNRWKTGTRNGKVIATLRSIISQAGESRVGIAVPCYLR
NGVCIKSPNIPELDGKILQDHFEGAIVMNDCTAMAYGEYFLRGGKYDPLLLVALGTGVGA
GFVYKSSPYVGRGSAMEIGHLKGFSEMKCYCGRRGCLETVLGGRYNDLPRMEKMARNGEK
EGLRFMEEYGRTLARGIATAIQLLDPEIVVIGGSAARAYDLFERSMKEELHNLLSFITPD
DIIFERARSEESGALGAALIADRGLI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggttctgggtatcgacgtgggtggcacgaaaatcctcgctgcaagggttgaggatggc
aaaattttgaataggtggaagacaggcactaggaatgggaaggtgatagccacactcagg
tccatcatctcgcaggcgggagaatcgagggtgggcatcgccgtgccatgctatttgaga
aatggcgtgtgtattaaatcccccaacatacccgagctcgatggaaagattctgcaagat
cattttgagggtgctattgtgatgaacgactgcactgccatggcctacggggagtacttt
ctccgtggagggaaatacgatcctctcctgcttgtcgctctcggcacgggtgtgggtgca
ggttttgtttataaatcctccccctatgtgggtaggggaagtgcgatggagatcggccat
ttgaagggattttctgagatgaaatgctactgtggaaggcgaggatgcctggaaactgtt
ctgggtgggaggtacaatgaccttccccgcatggaaaaaatggccagaaatggagaaaag
gagggattgaggttcatggaagaatacgggaggacactggcaaggggaattgcaacggca
attcaattacttgatcctgaaattgttgtgattggaggaagtgctgccagggcttatgat
ctgtttgaaagatccatgaaggaagagcttcacaacctgctgagcttcatcacgccggat
gatattatatttgagagggcaagatccgaagagtccggagctctcggtgccgccctgatt
gcggataggggattaatctag

DBGET integrated database retrieval system