KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0562Help
Entry
AciM339_0562      CDS       T02396                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AciM339_0562
Enzymes [BR:acf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AciM339_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484487..485329)
Genome map
AA seq 280 aa AA seqDB search
MPFLLYFGHVNIDIFLRVRDFGNAGESREVYSYFSRMGGTAYNAYRGLRALNVPSEIFSV
VGHNFEEDIEGHLVRDERTPTCWIITNGQEQMAYVYQGLWKELHKMDIDLPVEKYEYLHF
STGNPKFYLKIAREARNLGKKIVFDPSQEIHYVYTKELFEKMIDLSDMFFCNVQEYRRAR
EYAPSVLEEKIIVRTEGSSGASFYTPQNGWIHVSTSPARVVDTTGAGDTFRAGFYAALYR
GHDILDAVKYGNLAARRVVESPKTYYEGTWESLENMGNKI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcccttccttctttactttggccacgtgaatattgacatattcctgagggttagggat
tttggaaatgcaggtgagagcagggaggtttattcttatttttcaaggatgggaggtact
gcctataatgcatacaggggactccgagctttaaatgtcccctcagagatattctcagtt
gtgggtcataattttgaggaggatattgagggccatcttgtcagagatgagcgcactcca
acctgctggataataaccaacggccaggagcagatggcttacgtatatcagggactgtgg
aaggaactgcacaaaatggatattgatttacccgttgaaaaatatgaatacctgcacttt
tccacgggcaatccaaagttctatctaaaaattgcaagagaggccagaaaccttggcaag
aaaatagtatttgacccttctcaggaaatacattatgtttacacaaaagaactctttgaa
aagatgatagatctctccgacatgtttttctgcaacgttcaggagtatcggagggcgaga
gaatatgccccatcggttttggaagagaaaattatcgttaggactgaaggttccagtggt
gcaagtttttacacaccacagaatggatggatccatgtgtccacatcgcctgcaagggtt
gttgataccactggtgcaggagataccttccgggctggattttatgcagccctttacagg
ggacacgatattctggatgctgtgaaatatggaaacctggctgctcgaagagtagttgaa
tcgccaaaaacctattatgagggcacatgggaatcacttgaaaatatgggaaataagata
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system