KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0562Help
Entry
AciM339_0562      CDS       T02396                                 

Definition
(GenBank) sugar kinase, ribokinase
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AciM339_0562
   00240 Pyrimidine metabolism
    AciM339_0562
Enzymes [BR:acf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     AciM339_0562
    2.7.1.213  cytidine kinase
     AciM339_0562
    2.7.1.-  
     AciM339_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(484487..485329)
Genome map
AA seq 280 aa AA seqDB search
MPFLLYFGHVNIDIFLRVRDFGNAGESREVYSYFSRMGGTAYNAYRGLRALNVPSEIFSV
VGHNFEEDIEGHLVRDERTPTCWIITNGQEQMAYVYQGLWKELHKMDIDLPVEKYEYLHF
STGNPKFYLKIAREARNLGKKIVFDPSQEIHYVYTKELFEKMIDLSDMFFCNVQEYRRAR
EYAPSVLEEKIIVRTEGSSGASFYTPQNGWIHVSTSPARVVDTTGAGDTFRAGFYAALYR
GHDILDAVKYGNLAARRVVESPKTYYEGTWESLENMGNKI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcccttccttctttactttggccacgtgaatattgacatattcctgagggttagggat
tttggaaatgcaggtgagagcagggaggtttattcttatttttcaaggatgggaggtact
gcctataatgcatacaggggactccgagctttaaatgtcccctcagagatattctcagtt
gtgggtcataattttgaggaggatattgagggccatcttgtcagagatgagcgcactcca
acctgctggataataaccaacggccaggagcagatggcttacgtatatcagggactgtgg
aaggaactgcacaaaatggatattgatttacccgttgaaaaatatgaatacctgcacttt
tccacgggcaatccaaagttctatctaaaaattgcaagagaggccagaaaccttggcaag
aaaatagtatttgacccttctcaggaaatacattatgtttacacaaaagaactctttgaa
aagatgatagatctctccgacatgtttttctgcaacgttcaggagtatcggagggcgaga
gaatatgccccatcggttttggaagagaaaattatcgttaggactgaaggttccagtggt
gcaagtttttacacaccacagaatggatggatccatgtgtccacatcgcctgcaagggtt
gttgataccactggtgcaggagataccttccgggctggattttatgcagccctttacagg
ggacacgatattctggatgctgtgaaatatggaaacctggctgctcgaagagtagttgaa
tcgccaaaaacctattatgagggcacatgggaatcacttgaaaatatgggaaataagata
tag

DBGET integrated database retrieval system